DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4053 and CG43124

DIOPT Version :9

Sequence 1:NP_650601.2 Gene:CG4053 / 42070 FlyBaseID:FBgn0038482 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001247345.1 Gene:CG43124 / 12798282 FlyBaseID:FBgn0262587 Length:245 Species:Drosophila melanogaster


Alignment Length:235 Identity:53/235 - (22%)
Similarity:83/235 - (35%) Gaps:42/235 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 LDNRIVGGQEAEDG--VAPYQVSIQTIWKTHICSGVILNEQWILTAGHCALDFSIEDLRIIVGTN 93
            |:...|...|..:|  .||:...|.:..|. ||:|.::|..::|||..|..:  .|.|.:.:|:.
  Fly    23 LEEDCVDHMERINGSSYAPWLAEILSDSKV-ICAGALINNLYVLTAASCFKE--NEKLTVRLGSG 84

  Fly    94 DRLEPGQTLFPDEALVHCLYDIPYVYNNDIALIHVNESIIFNDRTQIVELSREQPPAGSTVTLTG 158
                     :.|::..:......|.:.......:.|...||..:|: ||......|...|.:...
  Fly    85 ---------YFDKSYENFRVTKAYFWMTHFPANNTNNLCIFRLQTE-VEFKTHIRPMCITKSPKS 139

  Fly   159 WGAPESSYPTVQYLQTLNLTIIAHEECRERWDFHDGIDIGHIC--TFTREGEGACSGDSGGPLMW 221
            .|              |..|.....|..:.|.|...|. |..|  .|....|...|..:|.|  |
  Fly   140 LG--------------LATTFEIINEKPKMWYFCKNIK-GLFCKYVFGENEEKWQSKPTGSP--W 187

  Fly   222 -----EGKLVGLVNWGRAC---GVGMPDMYANTVYYQDWI 253
                 .|...|||.:|...   .....::|.|.:.:.:||
  Fly   188 TETISNGPFKGLVRYGILSYRDNKTYDEVYINVMSHINWI 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4053NP_650601.2 Tryp_SPc 34..253 CDD:214473 50/230 (22%)
Tryp_SPc 35..256 CDD:238113 52/231 (23%)
CG43124NP_001247345.1 Tryp_SPc 41..>133 CDD:304450 23/104 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.