DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4053 and LOC101730792

DIOPT Version :9

Sequence 1:NP_650601.2 Gene:CG4053 / 42070 FlyBaseID:FBgn0038482 Length:265 Species:Drosophila melanogaster
Sequence 2:XP_031762443.1 Gene:LOC101730792 / 101730792 -ID:- Length:146 Species:Xenopus tropicalis


Alignment Length:139 Identity:44/139 - (31%)
Similarity:68/139 - (48%) Gaps:7/139 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 ALIHVNESIIFNDRTQIVELSRE--QPPAGSTVTLTGWGAPES--SYPTVQYLQTLNLTIIAHEE 184
            ||:.:|....:|....:|.|..:  .|..|....::|||...:  ..|: ..|:::.|.|:...:
 Frog     7 ALLPLNRPAFYNAFVSVVPLPIQGVSPIEGRLCQVSGWGFTSTIGGKPS-DTLRSVKLPIVPMRK 70

  Fly   185 CRERWDFHDGIDIGHICT-FTREGEGACSGDSGGPLMWEGKLVGLVNWGRAC-GVGMPDMYANTV 247
            |.....:...|....||. |...|:.||.|||||||:.:||:.|:|:||.:| ....|.:|....
 Frog    71 CNSSASYAGHITSNMICAGFITGGKDACQGDSGGPLVCDGKVYGVVSWGHSCANPKYPGVYTAVA 135

  Fly   248 YYQDWIRRT 256
            .:|.||.||
 Frog   136 NFQRWIYRT 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4053NP_650601.2 Tryp_SPc 34..253 CDD:214473 40/134 (30%)
Tryp_SPc 35..256 CDD:238113 42/137 (31%)
LOC101730792XP_031762443.1 Tryp_SPc <7..141 CDD:214473 40/134 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.