DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4053 and Klk9

DIOPT Version :9

Sequence 1:NP_650601.2 Gene:CG4053 / 42070 FlyBaseID:FBgn0038482 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_082936.2 Gene:Klk9 / 101533 MGIID:1921082 Length:251 Species:Mus musculus


Alignment Length:238 Identity:76/238 - (31%)
Similarity:118/238 - (49%) Gaps:23/238 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 DNRIVGGQEAEDGVAPYQVSIQTIWKTHICSGVILNEQWILTAGHCALDFSIEDLRIIVGTND-- 94
            |.|.||.:|......|:|..:..:.: .:|...::|:||:|||.||...:    |.:.:|.:.  
Mouse    20 DTRAVGARECVRNSQPWQAGLFYLTR-QLCGATLINDQWLLTAAHCRKPY----LWVRLGEHHLW 79

  Fly    95 RLE-PGQTLFPDEALVHCLYDIPYV----YNNDIALIHVNESIIFNDRTQIVELSREQPPAGSTV 154
            |.| |.|.|...:...|..:: |.:    :|:||.||.:...:......|.:.|:..:||.|:..
Mouse    80 RWEGPEQLLLVTDFFPHPGFN-PDLSANDHNDDIMLIRLPRKVRLTPAVQPLNLTESRPPVGTQC 143

  Fly   155 TLTGWGAPESS---YPTVQYLQTLNLTIIAHEECRERWDFHDGIDIGHICTFTRE-GEGACSGDS 215
            .::|||:..||   ||..  ||..|::|:.::.|  ||.:...|....:|....| |.|:|.|||
Mouse   144 LISGWGSVSSSKLQYPMT--LQCANISILDNKLC--RWAYPGHISEKMLCAGLWEGGRGSCQGDS 204

  Fly   216 GGPLMWEGKLVGLVNWG-RACG-VGMPDMYANTVYYQDWIRRT 256
            ||||:.||.|.|:|:.| ..|. ...|.:|.|...|.:||..|
Mouse   205 GGPLVCEGTLAGIVSGGSEPCSRPRRPAVYTNVFDYLEWIEST 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4053NP_650601.2 Tryp_SPc 34..253 CDD:214473 72/231 (31%)
Tryp_SPc 35..256 CDD:238113 73/233 (31%)
Klk9NP_082936.2 Tryp_SPc 24..247 CDD:238113 73/232 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.