DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4053 and Gm2663

DIOPT Version :9

Sequence 1:NP_650601.2 Gene:CG4053 / 42070 FlyBaseID:FBgn0038482 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001096130.1 Gene:Gm2663 / 100040208 MGIID:3780832 Length:247 Species:Mus musculus


Alignment Length:233 Identity:74/233 - (31%)
Similarity:115/233 - (49%) Gaps:18/233 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 DNRIVGGQEAEDGVAPYQVSIQTIWKTHICSGVILNEQWILTAGHCALDFSIEDLRIIVGTN--D 94
            |::||||........|||||:.. ..:|.|.|.::|:||:|:|.||..    ..|::.:|.:  |
Mouse    21 DDKIVGGYTCPKHSVPYQVSLND-GISHQCGGSLINDQWVLSAAHCYK----RRLQVRLGEHNID 80

  Fly    95 RLEPGQTLFPDEALV-HCLYDIPYVYNNDIALIHVNESIIFNDRTQIVELSREQPPAGSTVTLTG 158
            .||.|:.....|.:: |..|:...| :|||.||.:....|.|.:...|.|.|......:...::|
Mouse    81 VLEGGEQFIDAEKIIRHPDYNKDTV-DNDIMLIKLKSPAILNSQVSTVSLPRSCASTNAQCLVSG 144

  Fly   159 WGAPES---SYPTVQYLQTLNLTIIAHEECRERWDFHDGIDIGHICT-FTREGEGACSGDSGGPL 219
            ||...|   .||.:  ||.|...:::...|::  .:...|.....|. |...|:.:|.||||||:
Mouse   145 WGNTVSIGGKYPAL--LQCLEAPVLSASSCKK--SYPGQITSNMFCLGFLEGGKDSCDGDSGGPV 205

  Fly   220 MWEGKLVGLVNWGRACGV-GMPDMYANTVYYQDWIRRT 256
            :..|::.|:|:||..|.: |.|.:|.....|..||:.|
Mouse   206 VCNGEIQGIVSWGSVCAMRGKPGVYTKVCNYLSWIQET 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4053NP_650601.2 Tryp_SPc 34..253 CDD:214473 70/226 (31%)
Tryp_SPc 35..256 CDD:238113 72/228 (32%)
Gm2663NP_001096130.1 Tryp_SPc 23..240 CDD:214473 70/226 (31%)
Tryp_SPc 24..243 CDD:238113 72/228 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.