DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17475 and Klk12

DIOPT Version :9

Sequence 1:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_081373.1 Gene:Klk12 / 69511 MGIID:1916761 Length:247 Species:Mus musculus


Alignment Length:279 Identity:83/279 - (29%)
Similarity:121/279 - (43%) Gaps:57/279 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VILLACTCYKPISAVRLAQLSEDQLEWISKAEGVNFQNRVINGEDVQLGEAKYQISLQGMYGGHI 75
            ::||.|       ||.|:|...:               ::.||.:.......:|:.|  .:|.::
Mouse     5 ILLLLC-------AVGLSQADRE---------------KIYNGVECVKNSQPWQVGL--FHGKYL 45

  Fly    76 -CGGCIIDERHVLTAAHCVYGYN-------------PTYLRVITGTVEYEKPDAVYFVEEHWIHC 126
             |||.::|.:.|||||||...|.             ...||..|.::.:......|...||    
Mouse    46 RCGGVLVDRKWVLTAAHCRDKYVVRLGEHSLTKLDWTEQLRHTTFSITHPSYQGAYQNHEH---- 106

  Fly   127 NYNSPDYHNDIALIRLNDTIKFNEYTQPAELPTAPVANGTQLLLTGWGST-ELWGDTPDILQKAY 190
                     |:.|:|||..|......:|..||::.|..|....::|||:| :.|...||.||...
Mouse   107 ---------DLRLLRLNRPIHLTRAVRPVALPSSCVTTGAMCHVSGWGTTNKPWDPFPDRLQCLN 162

  Fly   191 LTHVVYSTCQEIMNNDPSNGPCHICTLTTGGQGACHGDSGGPLTHNGVLYGLVNWGY--PCA-LG 252
            |:.|...||:.:.....:..  .:|.....|:.||.|||||||...|||.|||:||.  ||. .|
Mouse   163 LSTVSNETCRAVFPGRVTEN--MLCAGGEAGKDACQGDSGGPLVCGGVLQGLVSWGSVGPCGQKG 225

  Fly   253 VPDSHANVYYYLEWIRSMI 271
            :|..:..|..|.:|||.:|
Mouse   226 IPGVYTKVCKYTDWIRIVI 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 72/235 (31%)
Tryp_SPc 50..269 CDD:238113 74/236 (31%)
Klk12NP_081373.1 Tryp_SPc 21..240 CDD:214473 72/235 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.