DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17475 and CG17242

DIOPT Version :9

Sequence 1:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_001259921.1 Gene:CG17242 / 59226 FlyBaseID:FBgn0250841 Length:245 Species:Drosophila melanogaster


Alignment Length:252 Identity:64/252 - (25%)
Similarity:107/252 - (42%) Gaps:30/252 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 VRLAQLSEDQLEWISKAEGVNFQNRVINGEDVQLGEAKYQISLQGMYGGHICGGCIIDERHVLTA 89
            |.:||::.|     .|:.|:.              :|.:|.|:| :...|.|||.|..|..:||.
  Fly    10 VSIAQIAAD-----FKSIGIE--------------QAPWQASVQ-INDKHHCGGVIYSEDIILTI 54

  Fly    90 AHCVYGYNPTYLRVITGTVEYEKPDAVYFVEEHWIHCNYNSPDYHNDIALIRLNDTIKFNEYTQP 154
            |.||......::.|..|:.:......|..||:..:......|   :|:|:::|...:..:...:.
  Fly    55 AECVRKARLEFISVRVGSAQENAGGTVLKVEKMRLQVLGLRP---SDVAILQLRSPLYLDGGIRA 116

  Fly   155 AELPTAPVANGTQLLLTGWGSTELWGDTPDILQKAYL---THVVYSTCQEIMNNDPSNGPCHICT 216
            ..|.|.|:..||...::|||.......:.::|.:..:   ..::.:|...:.....|.|  .||.
  Fly   117 IPLATIPLVPGTNASVSGWGQLSAMNPSSEVLLRVDVKIQDQLMCATNLALKGRLMSVG--EICA 179

  Fly   217 LTTGG-QGACHGDSGGPLTHNGVLYGLVNWGYPC-ALGVPDSHANVYYYLEWIRSMI 271
            ...|. ..||.|..||||..|..|||:::|...| .|.....:||:..:..||.|.:
  Fly   180 APAGEIPYACQGFVGGPLVANNRLYGILSWQSACDVLNKSSVYANIAMFKVWIESTV 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 55/222 (25%)
Tryp_SPc 50..269 CDD:238113 57/223 (26%)
CG17242NP_001259921.1 Tryp_SPc 24..235 CDD:238113 57/230 (25%)
Tryp_SPc 24..232 CDD:214473 55/227 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.