DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17475 and CG17239

DIOPT Version :9

Sequence 1:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_001259920.1 Gene:CG17239 / 59224 FlyBaseID:FBgn0042186 Length:248 Species:Drosophila melanogaster


Alignment Length:244 Identity:68/244 - (27%)
Similarity:104/244 - (42%) Gaps:12/244 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 LEWISKAEGVN------FQNRVINGEDVQLGEAKYQISLQGMYGGHICGGCIIDERHVLTAAHCV 93
            ::||..|..|.      ...|::.|:.:.:....:|.|:..: |...||..|..|..|:|||||:
  Fly     3 VQWIFLAFSVTVVSSNWIPERIVGGDLITILSVPWQASILRL-GRFHCGAAIYSEDIVITAAHCL 66

  Fly    94 YGYNPTYLRVITGTVEYEKPDAVYFVEEHWIHCNYNSPDYHNDIALIRLNDTIKFNEYTQPAELP 158
            ......:|.|..|:........|..|....:|..|:. .:.||||::||...::.........|.
  Fly    67 TDRETEFLSVRVGSSFTFFGGQVVRVSSVLLHEEYDQ-SWSNDIAVMRLQSKLRLGSAVSVIPLA 130

  Fly   159 TAPVANGTQLLLTGWGSTELWGDTPDILQKAYLTHVVYSTCQEIMNNDPSNGPCHICTLTTGGQG 223
            ..|.|:|:...::|||:.....:.|..:..|.:..|....|:.......:..  .||. ...|:.
  Fly   131 DTPPASGSPATVSGWGAIGFKKNYPMSILSASVDIVDQDQCRRSYGRKITKD--MICA-AAPGKD 192

  Fly   224 ACHGDSGGPLTHNGVLYGLVNWGYPCA-LGVPDSHANVYYYLEWIRSMI 271
            ||.|||||||.....|.|:|::|..|| ...|..:|||.....||...|
  Fly   193 ACSGDSGGPLVSGNKLVGIVSFGKECAHPEYPGVYANVAELKPWILGAI 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 61/218 (28%)
Tryp_SPc 50..269 CDD:238113 62/219 (28%)
CG17239NP_001259920.1 Tryp_SPc 23..237 CDD:214473 61/218 (28%)
Tryp_SPc 24..237 CDD:238113 60/217 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.