DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17475 and CG18754

DIOPT Version :9

Sequence 1:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster


Alignment Length:265 Identity:73/265 - (27%)
Similarity:116/265 - (43%) Gaps:66/265 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 FQNRVINGEDVQLGEAKYQISLQGMYGGHICGGCIIDERHVLTAAHCVYG----YNPTYLR-VIT 105
            |::|  ..|:.:|.|..:.:.|  :|...:   .:|  |:||||||||.|    .|...|: |..
  Fly   104 FRDR--GAENAELNEYPWMVLL--LYENRL---SLI--RYVLTAAHCVIGGYLTQNDLVLKSVRL 159

  Fly   106 G-------TVEYEKPDAVYFVEEHWIHCNYNSP--DYHNDIALIRLNDTIKFNEYTQP-----AE 156
            |       |.|...|.....|.:..:|..:.|.  .|.|||||:||...:::.:..||     ||
  Fly   160 GESTTDCITSESRCPHLDVEVGQTTVHQGFTSSGGTYRNDIALLRLQFPVRYTKKIQPICLLDAE 224

  Fly   157 LPTAPVANGTQLLLTGWGSTELWGDTPDILQKAYLTHVVYSTCQE-----IMNNDPS-NGPCHIC 215
            .|...:    .|.::||..|           |:..| ::.||.:|     .:|..|| .....:|
  Fly   225 FPLQDL----NLQISGWDPT-----------KSSQT-LITSTVKERNPADCLNRYPSFRSASQVC 273

  Fly   216 TLTTGGQ---GACHGDSGGP---LTHNGV-----LYGLVNWG--YPCALGVPDSHANVYYYLEWI 267
               .|||   ..|.|.||.|   :..:||     |.|:.::|  |..:.|:|..:..:.::.|||
  Fly   274 ---AGGQRKGDTCAGISGSPVMGIMGSGVDEFVFLAGIASYGQQYCYSAGIPGVYTKIGHFSEWI 335

  Fly   268 RSMIS 272
            ::.::
  Fly   336 KANLA 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 70/255 (27%)
Tryp_SPc 50..269 CDD:238113 71/256 (28%)
CG18754NP_652652.3 CLIP 35..84 CDD:288855
Tryp_SPc 108..338 CDD:238113 71/255 (28%)
Tryp_SPc 108..335 CDD:214473 69/252 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437211
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.