DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17475 and CG34409

DIOPT Version :9

Sequence 1:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_001097728.2 Gene:CG34409 / 5740854 FlyBaseID:FBgn0085438 Length:511 Species:Drosophila melanogaster


Alignment Length:301 Identity:77/301 - (25%)
Similarity:116/301 - (38%) Gaps:105/301 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 GVNFQNRVINGEDVQLGEAKY--QISLQGMYGGHI---CGGCIIDERHVLTAAHCVYG----YNP 98
            |:|.::|::.|:....|:..:  :|:.:......|   |.|.:|...|::||||||..    ...
  Fly   243 GINVESRLLGGDQASAGQFPWLTRIAYRNRSSSRISFRCSGSLISSNHIVTAAHCVVNLVSDLEL 307

  Fly    99 TYLRVITGTVEYEKPDAVYFVEEHWIHCNYNSPDYHNDIALIRLNDTIKFNEYTQPAELP-TAPV 162
            :::|:  |:.:...|   :.:|:..:|.||:.|.|.|||||:|:|.|   |....|..|| ..|:
  Fly   308 SHVRL--GSQDGATP---FAIEQVIVHPNYDQPKYANDIALLRINST---NGTFTPICLPFNGPI 364

  Fly   163 ANGTQLL-----LTGW--GSTELWGDTPDILQKAYLTHVVYSTCQEIMNN---DPSNG------- 210
            ..|.:|:     ..||  ||||                          ||   ||||.       
  Fly   365 TLGNRLIGQIGVAAGWSIGSTE--------------------------NNSSMDPSNSTAGVRFI 403

  Fly   211 ----------------------------PCHICTLTTGGQGACHGDSGGPLTHNG---------- 237
                                        |.|:|.........|.||||||...:|          
  Fly   404 RLPIVNTTSCAIAYASLSENFQQPIVITPNHLCAQGMPMNDVCRGDSGGPFMDDGTSGVFGTSGR 468

  Fly   238 -VLYGLVNWGYPCALGV---PDSHANVYYYLEWI-RSMISG 273
             .:.|:|.:| |...||   |..:..|..:.:|| ||:..|
  Fly   469 YTIIGIVAFG-PTLCGVTTIPGVYTLVSSFSDWILRSIAEG 508

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 70/286 (24%)
Tryp_SPc 50..269 CDD:238113 71/288 (25%)
CG34409NP_001097728.2 CLIP 26..71 CDD:288855
Tryp_SPc 249..501 CDD:214473 70/286 (24%)
Tryp_SPc 252..501 CDD:238113 69/283 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437253
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.