DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17475 and CG34171

DIOPT Version :10

Sequence 1:NP_650600.2 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_001097175.2 Gene:CG34171 / 5740474 FlyBaseID:FBgn0085200 Length:292 Species:Drosophila melanogaster


Alignment Length:262 Identity:53/262 - (20%)
Similarity:103/262 - (39%) Gaps:57/262 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 DFLN--SEFKKLCKEPAALTLSDLPNELISQVMKNLDPQNRLTLRKVSRKLKDGIDMCGFKSITL 70
            |.||  ...|.:.||...:....||.....|..:.|:.:|....|::..|.:..:|:.. :.:.|
  Fly   363 DALNVLMAMKIISKEKKEIRWHGLPTSNTLQECEELEKENEKARRRIEIKQQQLLDLVQ-QHVAL 426

  Fly    71 NGFDDYVKLVLDGKCLEYTDMYEGCLVKHKNTLKLIRDTTILQLVYRNLVTLLKYKINTFNLS-- 133
            .      .|:...|..|     |..|:.:.|        :.:||.:..:.|..|..||. |:|  
  Fly   427 K------SLIARNKANE-----ERGLIPNPN--------SAVQLPFIIVNTDRKSNINC-NISND 471

  Fly   134 ---YWFFNNNPTFRDT-ELSKLIETLKKVEIVKA-RKLRLNRLSTKEITAVLQFFEPQLLETIQI 193
               |.|     .|.|: |:...::.||::.:..| .|...:....|:|.:::    |:.:|. .|
  Fly   472 KSEYSF-----KFEDSFEIHDDVQILKRIGLSLALEKGHYSETDLKKIKSMV----PKAVEK-YI 526

  Fly   194 EHAGKADQFNEIVQLQQWRSANTVTVRFLHDKP----TVPLENYFHFNVFQTFVVDFSVDDAIKI 254
            :..|...:.:::   ..|..::      |::.|    ::..::...||    ...:..:||.:|.
  Fly   527 DAYGLGFEQDDV---DDWEMSS------LYNGPDNDDSLSTQDMLAFN----DTTNDMLDDEMKF 578

  Fly   255 RD 256
            .|
  Fly   579 ED 580

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17475NP_650600.2 Tryp_SPc 50..269 CDD:238113 42/218 (19%)
CG34171NP_001097175.2 Tryp_SPc 38..263 CDD:473915
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.