DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17475 and AZU1

DIOPT Version :9

Sequence 1:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_001691.1 Gene:AZU1 / 566 HGNCID:913 Length:251 Species:Homo sapiens


Alignment Length:286 Identity:72/286 - (25%)
Similarity:114/286 - (39%) Gaps:52/286 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVRLGVVQILVILLACTCYKPISAVRLAQLSEDQLEWISKAEGVNFQNRVINGEDVQLGEAKYQI 65
            |.||.|:.:|..|||                       |...|.:....::.|...:..:..:..
Human     1 MTRLTVLALLAGLLA-----------------------SSRAGSSPLLDIVGGRKARPRQFPFLA 42

  Fly    66 SLQGMYGGHICGGCIIDERHVLTAAHCVYGYNPTYLRVITGTVEYEKPD-------AVYFVEEHW 123
            |:|.. |.|.|||.:|..|.|:|||.|....||....|:.|..:..:.:       ::..:.|: 
Human    43 SIQNQ-GRHFCGGALIHARFVMTAASCFQSQNPGVSTVVLGAYDLRRRERQSRQTFSISSMSEN- 105

  Fly   124 IHCNYNSPDYHNDIALIRLNDTIKFNEYTQ--PAELPTAPVANGTQLLLTGWGSTELWGDTPDIL 186
               .|:.....||:.|::|:..........  |..|..|.|..||:..:.||||....|......
Human   106 ---GYDPQQNLNDLMLLQLDREANLTSSVTILPLPLQNATVEAGTRCQVAGWGSQRSGGRLSRFP 167

  Fly   187 QKAYLTHVVYSTCQEIMNNDPSNGPCHICT--LTTGGQGACHGDSGGPLTHNGVLYGLVNWGY-P 248
            :...:|......|:          |.::||  ||..| |.|:||.|.||...|:.:|:.::.. |
Human   168 RFVNVTVTPEDQCR----------PNNVCTGVLTRRG-GICNGDGGTPLVCEGLAHGVASFSLGP 221

  Fly   249 CALGVPDSHANVYYYLEWIRSMISGP 274
            |..| ||....|..:.:||..:::.|
Human   222 CGRG-PDFFTRVALFRDWIDGVLNNP 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 59/229 (26%)
Tryp_SPc 50..269 CDD:238113 61/230 (27%)
AZU1NP_001691.1 Tryp_SPc 27..240 CDD:238113 60/229 (26%)
Possesses antibiotic activity. /evidence=ECO:0000269|PubMed:8506327 46..70 12/24 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6415
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.870

Return to query results.
Submit another query.