DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17475 and PRTN3

DIOPT Version :9

Sequence 1:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_002768.3 Gene:PRTN3 / 5657 HGNCID:9495 Length:256 Species:Homo sapiens


Alignment Length:233 Identity:77/233 - (33%)
Similarity:110/233 - (47%) Gaps:24/233 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 VINGEDVQLGEAKYQISLQ--GMYGGHICGGCIIDERHVLTAAHCVYGYNPTYLRVITG--TVEY 110
            ::.|.:.|.....|..|||  |..|.|.|||.:|....|||||||:.......:.|:.|  .|..
Human    28 IVGGHEAQPHSRPYMASLQMRGNPGSHFCGGTLIHPSFVLTAAHCLRDIPQRLVNVVLGAHNVRT 92

  Fly   111 EKPDAVYFVEEHWIHCNYNSPDYHNDIALIRLNDTIKFNEYTQPAELP--TAPVANGTQLLLTGW 173
            ::|...:|........||::.:..||:.||:|:.....:......:||  ..||.:|||.|..||
Human    93 QEPTQQHFSVAQVFLNNYDAENKLNDVLLIQLSSPANLSASVATVQLPQQDQPVPHGTQCLAMGW 157

  Fly   174 GSTELWGDTPDILQKAYLTHVVYSTCQEIMNNDPSNGPCHICTLTTGGQ-GACHGDSGGPLTHNG 237
            |..........:||:..:| ||...|:          |.:|||.....: |.|.|||||||..:|
Human   158 GRVGAHDPPAQVLQELNVT-VVTFFCR----------PHNICTFVPRRKAGICFGDSGGPLICDG 211

  Fly   238 VLYGL---VNWGYPCALGV-PDSHANVYYYLEWIRSMI 271
            ::.|:   |.||  ||..: ||....|..|::||||.:
Human   212 IIQGIDSFVIWG--CATRLFPDFFTRVALYVDWIRSTL 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 73/227 (32%)
Tryp_SPc 50..269 CDD:238113 75/229 (33%)
PRTN3NP_002768.3 Tryp_SPc 28..246 CDD:238113 76/230 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6415
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.870

Return to query results.
Submit another query.