DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17475 and Klk11

DIOPT Version :9

Sequence 1:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_001170844.1 Gene:Klk11 / 56538 MGIID:1929977 Length:276 Species:Mus musculus


Alignment Length:244 Identity:72/244 - (29%)
Similarity:120/244 - (49%) Gaps:28/244 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 VNFQNRVINGEDVQLGEAKYQISLQGMYGGHICGGCIIDERHVLTAAHCVYGYNPTYLRVITGTV 108
            |..:.|:|.|.:.:.....:|::| ......:||..:|..:.:||||||   ..|.|: ::.|..
Mouse    42 VGGETRIIKGYECRPHSQPWQVAL-FQKTRLLCGATLIAPKWLLTAAHC---RKPHYV-ILLGEH 101

  Fly   109 EYEKPDAV---YFVEEHWIHCNYN----SPDYHNDIALIRLNDTIKFNEYTQPAELPTAPVANGT 166
            ..||.|..   ....|.:.|.::|    :.|:.|||.|::::..:.|....||..|....||.||
Mouse   102 NLEKTDGCEQRRMATESFPHPDFNNSLPNKDHRNDIMLVKMSSPVFFTRAVQPLTLSPHCVAAGT 166

  Fly   167 QLLLTGWGSTELWGDTPDI-----LQKAYLTHVVYSTCQEIMNNDPSN-GPCHIC-TLTTGGQGA 224
            ..|::|||:|    .:|.:     |:.|.::.:.:..|::..   |.| ....:| ::...|:.:
Mouse   167 SCLISGWGTT----SSPQLRLPHSLRCANVSIIEHKECEKAY---PGNITDTMLCASVRKEGKDS 224

  Fly   225 CHGDSGGPLTHNGVLYGLVNWGY-PCAL-GVPDSHANVYYYLEWIRSMI 271
            |.|||||||..||.|.|:::||. |||: ..|..:..|..|..||..::
Mouse   225 CQGDSGGPLVCNGSLQGIISWGQDPCAVTRKPGVYTKVCKYFNWIHEVM 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 69/233 (30%)
Tryp_SPc 50..269 CDD:238113 70/234 (30%)
Klk11NP_001170844.1 Tryp_SPc 47..269 CDD:214473 69/233 (30%)
Tryp_SPc 48..272 CDD:238113 70/235 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.