DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17475 and prss1.2

DIOPT Version :9

Sequence 1:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_001011251.1 Gene:prss1.2 / 496697 XenbaseID:XB-GENE-6083469 Length:249 Species:Xenopus tropicalis


Alignment Length:219 Identity:65/219 - (29%)
Similarity:106/219 - (48%) Gaps:43/219 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 CGGCIIDERHVLTAAHCVYGYNPTYLRVI----------TGTVEYEKPDAVYFVEEHWIHCNYNS 130
            |||.::..|.:::||||   |.|....|.          .||.::.:.:|.|      .|.:|..
 Frog    48 CGGSLVTPRWIISAAHC---YRPPKTLVAHLGDHDLTKEEGTEQHIQVEAAY------KHSSYKD 103

  Fly   131 PDYHNDIALIRLNDTIKFNEYTQPAELPTAPVANGTQLLLTGWGS--TELWGDTPDILQKAYLTH 193
            ..|.:||.|::|....::|:|.||..:..:....||:.|::|:|:  ::..|:.||.||      
 Frog   104 EAYDHDIMLVKLAKPAQYNQYVQPIPVARSCPREGTECLVSGYGNLRSDHIGEFPDRLQ------ 162

  Fly   194 VVYSTCQE--IMNNDPSNGPCH-------ICT-LTTGGQGACHGDSGGPLTHNGVLYGLVNWGYP 248
                 |.:  ::::......|.       .|. ...||:.:|..||||||..||.|||:|:||:.
 Frog   163 -----CVDVPVLSDSSCKASCRGLFTENMFCAGFLEGGKDSCQVDSGGPLVCNGELYGVVSWGWG 222

  Fly   249 CA-LGVPDSHANVYYYLEWIRSMI 271
            || ...|..:|.|..||.|::::|
 Frog   223 CAQRNAPGVYAKVCNYLRWVQNII 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 63/213 (30%)
Tryp_SPc 50..269 CDD:238113 64/215 (30%)
prss1.2NP_001011251.1 Tryp_SPc 23..245 CDD:238113 64/216 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.