DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17475 and epsilonTry

DIOPT Version :9

Sequence 1:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_525112.1 Gene:epsilonTry / 49080 FlyBaseID:FBgn0010425 Length:256 Species:Drosophila melanogaster


Alignment Length:265 Identity:81/265 - (30%)
Similarity:121/265 - (45%) Gaps:27/265 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 ILVILLACTCYKPISAVRLAQLSEDQLEWISKAEGVNFQNRVINGEDVQLGEAKYQISLQGMYGG 73
            :|:.:|||.....|....|.||                ..|::.|.:..:....||:||| .||.
  Fly     6 VLLSVLACALAGTIPDGLLPQL----------------DGRIVGGYETSIDAHPYQVSLQ-RYGS 53

  Fly    74 HICGGCIIDERHVLTAAHCVYGYNPTYLRVITGTVEYEKPDAVYFVEEHWIHCNYNSPDYHNDIA 138
            |.|||.|.....|:|||||:.......|::..|:..:....:|:.|.....|..|||....||||
  Fly    54 HFCGGSIYSHDIVITAAHCLQSIEAKDLKIRVGSTYWRSGGSVHSVRSFRNHEGYNSRTMVNDIA 118

  Fly   139 LIRLNDTIKFNEYTQPAELPTAPVANGTQLLLTGWGSTELWGDT-PDILQKAYLTHVVYSTCQEI 202
            :||:...:.|....:...:..:....|...:::|||:||..|.| ||.|....|..:..|.|:  
  Fly   119 IIRIESDLSFRSSIREIRIADSNPREGATAVVSGWGTTESGGSTIPDHLLAVDLEIIDVSRCR-- 181

  Fly   203 MNNDPSNG----PCHICTLTTGGQGACHGDSGGPLTHNGVLYGLVNWGYPCA-LGVPDSHANVYY 262
             :::...|    ...:|.... .:.||.|||||||.....|.|:|:|||.|. :..|..:|:|.:
  Fly   182 -SDEFGYGKKIKDTMLCAYAP-HKDACQGDSGGPLVSGDRLVGVVSWGYGCGDVRYPGVYADVAH 244

  Fly   263 YLEWI 267
            :.|||
  Fly   245 FHEWI 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 71/223 (32%)
Tryp_SPc 50..269 CDD:238113 72/224 (32%)
epsilonTryNP_525112.1 Tryp_SPc 30..249 CDD:214473 71/223 (32%)
Tryp_SPc 31..252 CDD:238113 72/224 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.