DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17475 and prtn3

DIOPT Version :9

Sequence 1:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_001006847.1 Gene:prtn3 / 448597 XenbaseID:XB-GENE-5805214 Length:245 Species:Xenopus tropicalis


Alignment Length:243 Identity:73/243 - (30%)
Similarity:109/243 - (44%) Gaps:18/243 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 WISKAEGVNFQNRVINGEDVQLGEAKYQISLQGMYGGHICGGCIIDERHVLTAAHCVYGYNPTYL 101
            |.|:..|.:...:::.|.:.......|..||| :.|.|.|||.:|..:.::|||||:.......:
 Frog    13 WASQVNGGSMHTQIVGGREATPNSHPYIASLQ-LRGRHFCGGSLIAPQFLMTAAHCMENTASNLV 76

  Fly   102 RVITGTVEYEKPDAV--YFVEEHWIHCNYNSPDYHNDIALIRLNDTIKFNEYTQPAELPTA--PV 162
            .|:.|.......:|.  .|.........:|.....|||.:::|:..:..|...|...||:|  .|
 Frog    77 TVVLGAHSLRANEATKQRFRVNQVFENGFNPLTLQNDIVILKLDRPVSLNGKVQVVSLPSANEDV 141

  Fly   163 ANGTQLLLTGWGSTELWGDTPDILQKAYLTHVVYSTCQEIMNNDPSNGPCHICTLTTGGQ-GACH 226
            ..|||.:..|||.....|..||.||:..:|....:.|:          |.:|||.....| |.|.
 Frog   142 PAGTQCVTAGWGRLSTEGQIPDRLQELNVTVTRQNLCR----------PNNICTGVFMQQAGICF 196

  Fly   227 GDSGGPLTHNGVLYGLVNWGY-PCALGV-PDSHANVYYYLEWIRSMIS 272
            |||||||..|||:.|:.::.. .|..|| ||..:.|..:..:|...|:
 Frog   197 GDSGGPLVCNGVIQGITSFIIRSCGNGVTPDFFSRVSLFRRFIDDAIN 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 68/224 (30%)
Tryp_SPc 50..269 CDD:238113 69/225 (31%)
prtn3NP_001006847.1 Tryp_SPc 26..241 CDD:238113 69/225 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.