DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17475 and Jon99Fii

DIOPT Version :9

Sequence 1:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_651799.1 Gene:Jon99Fii / 43621 FlyBaseID:FBgn0039777 Length:267 Species:Drosophila melanogaster


Alignment Length:254 Identity:82/254 - (32%)
Similarity:109/254 - (42%) Gaps:54/254 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 VNFQNRVINGEDVQLGEAKYQISLQGMYGGH---ICGGCIIDERHVLTAAHCVYGYNPTYLRVIT 105
            |..|.|:.||.....|:..|.:.|  ::.|:   .|||.||....|||||||..|.:..      
  Fly    32 VKIQGRITNGYPAYEGKVPYIVGL--LFSGNGNWWCGGSIIGNTWVLTAAHCTNGASGV------ 88

  Fly   106 GTVEY-----EKPDAVYFVEEHWI-------HCNYNSPDYHNDIALIRLNDTIKFNEYTQPAELP 158
             |:.|     .:|...     ||:       |.:|||.:.||||:||| ...:.|.......|||
  Fly    89 -TINYGASLRNQPQYT-----HWVGSGNFVQHHHYNSGNLHNDISLIR-TPHVDFWHLVNKVELP 146

  Fly   159 TAPVAN-------GTQLLLTGWGSTELWGDTPDILQKAYLTHVVYSTCQ---EIMNNDPSNGPCH 213
            :   .|       |...:.:|||.|......||.||...:..:..|.|.   .:.:|       .
  Fly   147 S---YNDRYQDYAGWWAVASGWGGTYDGSPLPDWLQAVDVQIMSQSDCSRSWSLHDN-------M 201

  Fly   214 ICTLTTGGQGACHGDSGGPL-THNG-VLYGLVNW--GYPCALGVPDSHANVYYYLEWIR 268
            ||..|.||:..|.||||||| ||.| .|.|:.::  ...|..|.|...:.|..||:|||
  Fly   202 ICINTNGGKSTCGGDSGGPLVTHEGNRLVGVTSFVSSAGCQSGAPAVFSRVTGYLDWIR 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 77/246 (31%)
Tryp_SPc 50..269 CDD:238113 79/248 (32%)
Jon99FiiNP_651799.1 Tryp_SPc 37..259 CDD:214473 77/246 (31%)
Tryp_SPc 38..262 CDD:238113 79/248 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436822
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.