DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17475 and CG9737

DIOPT Version :9

Sequence 1:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster


Alignment Length:296 Identity:86/296 - (29%)
Similarity:129/296 - (43%) Gaps:69/296 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 QLEWISKAEGVNF--------QNRVINGEDVQLGEAKYQISLQGMYGGHICGGCIIDERHVLTAA 90
            :::.:..:.|.|.        .||:..||..:|.|..:...|......:.|.|.:||:||:||||
  Fly   126 RIQTVEPSSGFNLLNECGKQVTNRIYGGEIAELDEFPWLALLVYNSNDYGCSGALIDDRHILTAA 190

  Fly    91 HCVYG----------------YN----------PTYLRVITGTVE--YEKPDAVYFVEEHWIHCN 127
            |||.|                :|          |.||......::  |||   ::...|:....|
  Fly   191 HCVQGEGVRDRQGLKHVRLGEFNVKTEPDCIEEPNYLSCADAALDIAYEK---IHVHPEYKEFSN 252

  Fly   128 YNSPDYHNDIALIRLNDTIKFNEYTQPAELPT----APVANGTQLLLTGWGSTELWG------DT 182
            |.    :||||:|||...:.|..:..|..||.    ..:|.|....::|||.|:|:.      .:
  Fly   253 YK----YNDIAIIRLKHPVSFTHFVMPICLPNKSEPLTLAEGQMFSVSGWGRTDLFNKYFINIHS 313

  Fly   183 PDILQKAYLTHVVYSTCQEIMNN-DPSNGPCHICTLTTGGQGA---CHGDSGGPLTH------NG 237
            | |..|..:.:|....|.:|:.. ....||..||   .||:.|   |.|||||||.:      ..
  Fly   314 P-IKLKLRIPYVSNENCTKILEGFGVRLGPKQIC---AGGEFAKDTCAGDSGGPLMYFDRQHSRW 374

  Fly   238 VLYGLVNWGY-PCAL-GVPDSHANVYYYLEWIRSMI 271
            |.||:|::|: .|.: |.|..:.||..|.:||.|::
  Fly   375 VAYGVVSYGFTQCGMAGKPAVYTNVAEYTDWIDSVV 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 80/267 (30%)
Tryp_SPc 50..269 CDD:238113 81/268 (30%)
CG9737NP_651783.1 CLIP 28..89 CDD:288855
Tryp_SPc 149..406 CDD:214473 80/267 (30%)
Tryp_SPc 150..409 CDD:238113 81/269 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.