DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17475 and CG11842

DIOPT Version :9

Sequence 1:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_651662.1 Gene:CG11842 / 43431 FlyBaseID:FBgn0039629 Length:319 Species:Drosophila melanogaster


Alignment Length:298 Identity:81/298 - (27%)
Similarity:124/298 - (41%) Gaps:87/298 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 CTCYKPI-------------SAVRLAQLSED-QLEWISKAEGVNFQNRVINGEDVQLGEAKYQIS 66
            ||.|.|:             .|.||....|: ::||                             
  Fly    66 CTSYAPLIIGGGPAVPKEFPHAARLGHKDENGEVEW----------------------------- 101

  Fly    67 LQGMYGGHICGGCIIDERHVLTAAHCVYGYNPTYLRVITGTVEYE--KPDA---VYFVEEHWIHC 126
                    .|||.:|.:|||||||||.|....:......|.:|::  ..||   .:.|::...|.
  Fly   102 --------FCGGTLISDRHVLTAAHCHYSPQGSVNIARLGDLEFDTNNDDADPEDFDVKDFTAHP 158

  Fly   127 NYNSPDYHNDIALIRLNDTIKFNEYTQPAELPTAPVANGTQLLLTGWGSTELWGDTPD-ILQKAY 190
            .::.|..:|||:::||:..:.||:|..||.||......||..:..|||..|:...|.: .|||..
  Fly   159 EFSYPAIYNDISVVRLSRPVTFNDYKHPACLPFDDGRLGTSFIAIGWGQLEIVPRTENKKLQKVK 223

  Fly   191 LTHVVYSTCQEIM--NND--PS--NGPCHICTLTTGGQGACHGDSGGPLTHNGVLYGLVNWGYPC 249
            |.:  |.|...|.  .||  |.  |....:|..:...:..|:||||||:    ::|   :..|||
  Fly   224 LYN--YGTRCRITADRNDELPEGYNATTQLCIGSNEHKDTCNGDSGGPV----LIY---HMDYPC 279

  Fly   250 --------ALGV-------PDSHANVYYYLEWIRSMIS 272
                    ::||       |..:..|::||:||:..::
  Fly   280 MYHVMGITSIGVACDTPDLPAMYTRVHFYLDWIKQQLA 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 69/244 (28%)
Tryp_SPc 50..269 CDD:238113 71/245 (29%)
CG11842NP_651662.1 Tryp_SPc 73..315 CDD:238113 77/287 (27%)
Tryp_SPc 73..312 CDD:214473 75/284 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437668
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.