DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17475 and CG11841

DIOPT Version :9

Sequence 1:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster


Alignment Length:291 Identity:73/291 - (25%)
Similarity:120/291 - (41%) Gaps:39/291 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LACTCYKPI---SAVRLAQLSED---QLEWISKAEGVNFQNRVINGEDVQLGEAKYQISLQGMYG 72
            ||||.:|.|   ..|.::....|   ..|.:....|  .:..:::|...:..|..:...|     
  Fly    32 LACTKFKQIVFEERVAISFFFTDAPITYETVDSCHG--SRPLIVDGTPAEPKEFPFAARL----- 89

  Fly    73 GH---------ICGGCIIDERHVLTAAHCVYGYNPTYLRVITGTVEYEKPDAVYFVEEHWI---- 124
            ||         .|||.:|..|.|||||||.:..:.....|..|.:|::........|:..:    
  Fly    90 GHRKTNNEIKWFCGGTLISNRLVLTAAHCFFSEHGEVNVVRLGELEFDTDTDDAEPEDFGVLALK 154

  Fly   125 -HCNYNSPDYHNDIALIRLNDTIKFNEYTQPAELPTAPVANGTQLLLTGWGSTELWGDTPDILQK 188
             |..:.:|..:|||.:::|:..:|||.|..||.||..........:..|||..:........|.|
  Fly   155 AHPGFENPQLYNDIGIVQLDREVKFNRYKHPACLPFDDGEQHESFIAIGWGQKKFAQKESKKLLK 219

  Fly   189 AYLTHVVYSTCQEIMNNDP-SNG---PCHICTLTTGGQGACHGDSGGPLT--HNGV-----LYGL 242
            ..|..........:..||. .||   ...:|..:...:..|:||||||:.  |..:     :.|:
  Fly   220 VQLQGYKDRCVSSVDANDELPNGYEPKSQLCIGSRDNKDTCNGDSGGPVLAYHKDLACMYHVMGI 284

  Fly   243 VNWGYPCAL-GVPDSHANVYYYLEWIRSMIS 272
            .:.|..|:. .:|.::..|:|:|.||:..::
  Fly   285 TSAGITCSTPDIPSAYTRVHYFLNWIKGELA 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 61/243 (25%)
Tryp_SPc 50..269 CDD:238113 63/244 (26%)
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 62/243 (26%)
Tryp_SPc 72..310 CDD:214473 61/242 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437669
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.