DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17475 and CG4815

DIOPT Version :9

Sequence 1:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_651607.1 Gene:CG4815 / 43360 FlyBaseID:FBgn0039568 Length:265 Species:Drosophila melanogaster


Alignment Length:287 Identity:67/287 - (23%)
Similarity:122/287 - (42%) Gaps:52/287 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VVQILVILLACTCYKPISAVRLAQLSEDQLEWISKAEGVNFQNRVINGEDVQLGEAKYQISLQGM 70
            :|::|:||         ::||..  :.::.||..:     |..|:.||....: |:...:.:| :
  Fly     7 LVRLLLIL---------NSVRTE--AGNREEWTGR-----FHPRIYNGIKTTV-ESLGGVGIQ-L 53

  Fly    71 YGGH--ICGGCIIDERHVLTAAHCVYGYNPTYLRVITG-TVEYEKPDAVYFVEEHW--------- 123
            :.|.  :|...::..||:||||||....|.:...||.| :.|:.           |         
  Fly    54 FNGRKLVCSATLLTPRHILTAAHCFENLNRSKFHVIGGKSAEFT-----------WHGNNFNKNK 107

  Fly   124 -----IHCNYNSPDYHNDIALIRLNDTIKFNEYTQPAELPTAPVANGTQLLLTGWG-STELWGDT 182
                 ||..|....:..|:|:.:....:: ::|...|:|..:.:....:|:..||| ...:|.::
  Fly   108 LIRVQIHPKYAKMKFIADVAVAKTKYPLR-SKYIGYAQLCRSVLHPRDKLIAAGWGFEGGVWDES 171

  Fly   183 PDILQKAYLTHVVYS-TCQEIMNNDPSNGPCHICTLTTGGQGACHGDSGGPLTHNGVLYGLVNWG 246
            .....::....:|.. .|::.:  |....|..||......:..|.|||||||.....:.|:..|.
  Fly   172 RKKTFRSMKVGIVSKRDCEKQL--DRKMPPNIICAGAYNNKTLCFGDSGGPLLLGRQVCGINTWT 234

  Fly   247 YPCALG-VPDSHANVYYYLEWIRSMIS 272
            :.|... .||.:..|.||.::|:..|:
  Fly   235 FKCGNNEKPDVYMGVRYYAKFIKRTIN 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 56/237 (24%)
Tryp_SPc 50..269 CDD:238113 56/238 (24%)
CG4815NP_651607.1 Tryp_SPc 49..259 CDD:304450 53/224 (24%)
Trypsin 49..256 CDD:278516 52/221 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436936
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.