DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17475 and SPE

DIOPT Version :9

Sequence 1:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_651168.1 Gene:SPE / 42791 FlyBaseID:FBgn0039102 Length:400 Species:Drosophila melanogaster


Alignment Length:294 Identity:79/294 - (26%)
Similarity:118/294 - (40%) Gaps:88/294 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 GVNFQNRVINGEDVQLGEAKYQISLQ------GMYGGHICGGCIIDERHVLTAAHCVYGYNPTYL 101
            |..|.:|:..|.:..|.|..:.:.||      ..|..: |||.:::.|:||||.||:        
  Fly   128 GFLFADRIFGGTNTTLWEFPWMVLLQYKKLFSETYTFN-CGGALLNSRYVLTAGHCL-------- 183

  Fly   102 RVITGTVEYEKPDAVYF---------------------------------VEEHWIHCNY--NSP 131
                .:.|.:|..||..                                 ||:..||..|  ||.
  Fly   184 ----ASRELDKSGAVLHSVRLGEWDTRTDPDCTTQMNGQRICAPKHIDIEVEKGIIHEMYAPNSV 244

  Fly   132 DYHNDIALIRLNDTIKFNEYTQPAELPTAPVANGT----QLLLTGWGSTELWGDTPDILQKAYLT 192
            |..|||||:||...:.:.:|.:|..|||..:....    .:.:.|||.||  ...|..: |..:|
  Fly   245 DQRNDIALVRLKRIVSYTDYVRPICLPTDGLVQNNFVDYGMDVAGWGLTE--NMQPSAI-KLKIT 306

  Fly   193 HVVY--STCQEIMNN-----DPSNGPCHICTLTTGGQ---GACHGDSGGPLT------HNGVLY- 240
            ..|:  ::|||..::     |.|.       :..|||   ..|.|||||||.      ...|.| 
  Fly   307 VNVWNLTSCQEKYSSFKVKLDDSQ-------MCAGGQLGVDTCGGDSGGPLMVPISTGGRDVFYI 364

  Fly   241 -GLVNWG-YPCAL-GVPDSHANVYYYLEWIRSMI 271
             |:.::| .||.| |.|..:.....:::||:..:
  Fly   365 AGVTSYGTKPCGLKGWPGVYTRTGAFIDWIKQKL 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 75/282 (27%)
Tryp_SPc 50..269 CDD:238113 76/283 (27%)
SPENP_651168.1 CLIP 42..94 CDD:314844
Tryp_SPc 135..397 CDD:238113 76/284 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437265
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.