DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17475 and CG16710

DIOPT Version :9

Sequence 1:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_651167.3 Gene:CG16710 / 42790 FlyBaseID:FBgn0039101 Length:372 Species:Drosophila melanogaster


Alignment Length:268 Identity:70/268 - (26%)
Similarity:115/268 - (42%) Gaps:59/268 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 RVINGEDVQLGEAKYQISL------QGMYGGHI---CGGCIIDERHVLTAAHC--VYGYNPTYLR 102
            |:..||:.|..|..:...:      :.::...:   |.|.:|..|:|||||||  :.|.:...:|
  Fly   105 RIFGGEETQPNELPWMALILYAHRSRSVWNERLVSRCAGSLITNRYVLTAAHCLRITGLDLRRVR 169

  Fly   103 VITGTVEYEKPDAVYFVEEHWIHCNYNSPDY---------------------HNDIALIRLNDTI 146
            :....: ...||.|..:... .||   :|::                     :|||||:||...:
  Fly   170 LGEHNI-LSNPDCVTHINGR-EHC---APEHLEIDVDLSIKHRHYMVFEERPYNDIALLRLKFPV 229

  Fly   147 KFNEYTQP--AELP---TAPVANGTQLLLTGWGSTELWGDTPDILQKAYLTHVVYSTCQEIMNND 206
            ::....:|  .:|.   :.|..:..:|.:.|||.:...|.: ::|.:||:..   ....|...::
  Fly   230 RYTAQIKPICVQLDYIFSNPSFSNHKLQIAGWGLSHKQGYS-NVLLQAYVNG---RNADECSLSE 290

  Fly   207 PSNG---PCHICTLTTGGQGACHGDSGGPL---THNG-----VLYGLVNWGY-PCALGVPDSHAN 259
            ||.|   ..|||....||...|.|||||||   ...|     .|.|:.::|| .|..| |.::..
  Fly   291 PSLGLDKETHICAGNLGGNDTCKGDSGGPLMAIMERGDEEFVYLAGITSYGYSQCGYG-PAAYTK 354

  Fly   260 VYYYLEWI 267
            ...::|||
  Fly   355 TSKFVEWI 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 68/266 (26%)
Tryp_SPc 50..269 CDD:238113 69/267 (26%)
CG16710NP_651167.3 CLIP 35..84 CDD:288855
Tryp_SPc 105..362 CDD:214473 68/266 (26%)
Tryp_SPc 106..362 CDD:238113 67/265 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437229
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.