DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17475 and CG31199

DIOPT Version :9

Sequence 1:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_732546.1 Gene:CG31199 / 42456 FlyBaseID:FBgn0051199 Length:293 Species:Drosophila melanogaster


Alignment Length:300 Identity:66/300 - (22%)
Similarity:108/300 - (36%) Gaps:59/300 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 QILVILLACTCYKPISAVRLAQLSEDQLEWISKAEGVNFQNR-VINGEDVQLGEAKYQISLQGMY 71
            :|.|:||....:.|  .||.|::::||.....:.:.:|.|:. .|..|...:....|....:|..
  Fly     4 RIAVLLLLVGLFGP--EVRSAKVNDDQCGAFDEDQMLNMQSTFAIPTEHQWVARIVYGKGFEGKI 66

  Fly    72 GGHICGGCIIDERHVLTAAHCVYGYN-----------------PTYLRVITGTVEYEKPDAVYFV 119
            ..:.|.|.::.:|.||..|||...||                 |..:||........:|.....:
  Fly    67 RDNGCLGVLVSKRTVLAPAHCFVQYNGVAEAFSVHLGVHNKSAPVGVRVCETDGYCVRPSQEIKL 131

  Fly   120 EEHWIHCNYNSPDYHNDIALIRLNDTIKFNEYTQPAELPTAPVANGT----QLLLTGWGSTELWG 180
            .|..||.:|:|....|.:|::.|....|......|..:|...:.|.|    ..::.|....|   
  Fly   132 AEIAIHPDYDSRTLKNSLAVLTLQRDAKIYPNVMPICMPPPSLLNETLVAQTFVVAGLRVFE--- 193

  Fly   181 DTPDILQKAYLTHVVYSTCQEIMNNDPSNGPCHICTLTTGGQGAC--HGDS-----GGPL----- 233
               |...|.::..:....||.           .:.||.|.....|  |...     |.||     
  Fly   194 ---DFRLKTWVNTLSRGFCQS-----------KVKTLVTSSNTVCGYHKQPVAYYLGAPLVGLQK 244

  Fly   234 ----THNGVLYG-LVNWGYPCALGVPDSHANVYYYLEWIR 268
                |.|..|.| :::|.:. ...:..|...:..|:::||
  Fly   245 KGHVTQNYYLVGIMIDWRWE-NNRIMSSFLAIRNYMDFIR 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 52/256 (20%)
Tryp_SPc 50..269 CDD:238113 53/256 (21%)
CG31199NP_732546.1 Tryp_SPc 45..257 CDD:304450 48/228 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.