DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17475 and CG31219

DIOPT Version :9

Sequence 1:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_001097837.1 Gene:CG31219 / 42344 FlyBaseID:FBgn0051219 Length:345 Species:Drosophila melanogaster


Alignment Length:236 Identity:59/236 - (25%)
Similarity:92/236 - (38%) Gaps:52/236 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 CGGCIIDERHVLTAAHCVYG------------------YNPTYLRVITGTVEYEKPDA------- 115
            |.|.:|:.|:|||:||||.|                  |:|.|           .||.       
  Fly   120 CAGSLINNRYVLTSAHCVNGIPRDLSLKSVRLGEHDITYDPAY-----------NPDCRDQDNQC 173

  Fly   116 -----VYFVEEHWIHCNYNSPDYHN---DIALIRLNDTIKFNEYTQPAELPTAPVANGTQLLLTG 172
                 ...:|:..:|..::|....|   ||||:||...:::.....|..:|.......::|.:.|
  Fly   174 ALPNLEIKLEKIIVHGLFSSISNRNIEYDIALLRLKMPVRYRTGIMPICIPKHGFFAKSKLEIAG 238

  Fly   173 WGSTELWGDTPDILQKAYLTHVVYSTCQEIMNNDPSNGPCHICTLTTGGQGACHGDSGGPL---T 234
            ||.|. .|....:|...::.....:.|.........|....||.....|...|.|||||||   .
  Fly   239 WGKTN-EGQFSQVLMHGFIRERSIAVCALRFPYLDLNQSLQICAGGYDGVDTCQGDSGGPLMVTM 302

  Fly   235 HNGVLY--GLVNWGYP-CA-LGVPDSHANVYYYLEWIRSMI 271
            .|..:|  |:..:|.. |. :|:|..:.....:|.||::::
  Fly   303 DNSSVYLAGITTYGSKNCGQIGIPGIYTRTSAFLPWIKAVL 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 57/230 (25%)
Tryp_SPc 50..269 CDD:238113 59/232 (25%)
CG31219NP_001097837.1 Tryp_SPc 88..339 CDD:214473 57/230 (25%)
Tryp_SPc 90..342 CDD:238113 59/233 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437217
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.