DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17475 and CG31266

DIOPT Version :9

Sequence 1:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster


Alignment Length:278 Identity:106/278 - (38%)
Similarity:145/278 - (52%) Gaps:20/278 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LVILLACTCYK---PISAVR--------LAQLSEDQLEWISKAEGVNFQNRVINGEDVQLGEAKY 63
            |.:||..|...   |..|:|        ||.:...:     ..|.|. |.|||.|.....|...:
  Fly     7 LTVLLGLTLLALQGPTEAMRMRGEPLPGLANIERHR-----STEAVP-QGRVIGGTTAAEGNWPW 65

  Fly    64 QISLQGMYGGHICGGCIIDERHVLTAAHCVYGYNPTYLRVITGTVEYEKPDAVYF-VEEHWIHCN 127
            ..|:|..|..|:||..|:||..|||||.||.|..|..|.|:||||::....|.|: |.:..:|||
  Fly    66 IASIQNAYSYHLCGAIILDETWVLTAASCVAGLRPLNLLVVTGTVDWWDLYAPYYTVSQIHVHCN 130

  Fly   128 YNSPDYHNDIALIRLNDTIKFNEYTQPAELPTA-PVANGTQLLLTGWGSTELWGDTPDILQKAYL 191
            ::.|.|||||||::|:..|:||:.|:...|... .:..|.:|...||||:|..|.....||:|..
  Fly   131 FDKPLYHNDIALLQLSSKIEFNDVTKNITLADIDELEEGDKLTFAGWGSSEAMGTYGRYLQEASG 195

  Fly   192 THVVYSTCQEIMNNDPSNGPCHICTLTTGGQGACHGDSGGPL-THNGVLYGLVNWGYPCALGVPD 255
            |::....|:|.:.|.......|:|.....||||||||:|||| .....|.|:.|||.||..|.||
  Fly   196 TYLPVDACREKLQNQDDVDLGHVCVQMDAGQGACHGDTGGPLIDEQQRLVGIGNWGVPCGRGYPD 260

  Fly   256 SHANVYYYLEWIRSMISG 273
            .:|...:|.:|||:.::|
  Fly   261 VYARTAFYHDWIRTTMNG 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 90/220 (41%)
Tryp_SPc 50..269 CDD:238113 91/221 (41%)
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 90/220 (41%)
Tryp_SPc 52..275 CDD:238113 92/222 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D104368at6960
OrthoFinder 1 1.000 - - FOG0007620
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.