DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17475 and CG4053

DIOPT Version :9

Sequence 1:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_650601.2 Gene:CG4053 / 42070 FlyBaseID:FBgn0038482 Length:265 Species:Drosophila melanogaster


Alignment Length:277 Identity:108/277 - (38%)
Similarity:154/277 - (55%) Gaps:18/277 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 VRLGVVQILVILLACTCYKPISAVRLAQLSEDQLEWISKAEGVNFQNRVINGEDVQLGEAKYQIS 66
            |||.::.:|::..:      |...|..:|...:|          ..||::.|::.:.|.|.||:|
  Fly     3 VRLSLIWLLLLGTS------IDVTRGKRLDNRKL----------LDNRIVGGQEAEDGVAPYQVS 51

  Fly    67 LQGMYGGHICGGCIIDERHVLTAAHCVYGYNPTYLRVITGTVEYEKPDAVYFVEEHWIHCNYNSP 131
            :|.::..|||.|.|::|:.:|||.||...::...||:|.||.:..:|....|.:|..:||.|:.|
  Fly    52 IQTIWKTHICSGVILNEQWILTAGHCALDFSIEDLRIIVGTNDRLEPGQTLFPDEALVHCLYDIP 116

  Fly   132 -DYHNDIALIRLNDTIKFNEYTQPAELPTAPVANGTQLLLTGWGSTELWGDTPDILQKAYLTHVV 195
             .|:||||||.:|::|.||:.||..||.......|:.:.|||||:.|....|...||...||.:.
  Fly   117 YVYNNDIALIHVNESIIFNDRTQIVELSREQPPAGSTVTLTGWGAPESSYPTVQYLQTLNLTIIA 181

  Fly   196 YSTCQEIMNNDPSNGPCHICTLTTGGQGACHGDSGGPLTHNGVLYGLVNWGYPCALGVPDSHANV 260
            :..|:|..:........||||.|..|:|||.|||||||...|.|.||||||..|.:|:||.:||.
  Fly   182 HEECRERWDFHDGIDIGHICTFTREGEGACSGDSGGPLMWEGKLVGLVNWGRACGVGMPDMYANT 246

  Fly   261 YYYLEWIRSMISGPCSN 277
            .||.:|||...|| |.|
  Fly   247 VYYQDWIRRTHSG-CKN 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 92/218 (42%)
Tryp_SPc 50..269 CDD:238113 93/219 (42%)
CG4053NP_650601.2 Tryp_SPc 34..253 CDD:214473 92/218 (42%)
Tryp_SPc 35..256 CDD:238113 94/220 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D104368at6960
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.030

Return to query results.
Submit another query.