DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17475 and CG31265

DIOPT Version :9

Sequence 1:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_650599.1 Gene:CG31265 / 42068 FlyBaseID:FBgn0051265 Length:266 Species:Drosophila melanogaster


Alignment Length:284 Identity:126/284 - (44%)
Similarity:166/284 - (58%) Gaps:24/284 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVRLGVVQILVILLACTCYKPISAVRLAQLSEDQLEWISKAEG---VNFQNRVINGEDVQLGEAK 62
            ::||.    |:||||.....|..:.|:.              |   .....|:..||:.::|.|.
  Fly     3 LLRLS----LLILLAVKPPNPCESKRIV--------------GPFPAGQSGRIKGGEEAEIGFAP 49

  Fly    63 YQISLQGMYGGHICGGCIIDERHVLTAAHCVYGYNPTYLRVITGTVEYEKPDAVYFVEEHWIHCN 127
            ||:|||.:.|.|.|||.|::|..::||.|||..:.|..:.|||||.::.:|.|:|:..|...||.
  Fly    50 YQVSLQPIVGSHNCGGAILNENWIITAGHCVENFIPALVNVITGTNKWAEPGAIYYTAEIHKHCM 114

  Fly   128 YNSPDYHNDIALIRLNDTIKFNEYTQPAELPTAPVANGTQLLLTGWGSTELWGDTPDILQKAYLT 192
            |:.|..||||||::|.:.|.|||.|||..|||.||..|.:::||||||...:|.:.:.|.|..:.
  Fly   115 YDQPYMHNDIALVKLTENITFNELTQPIALPTRPVQLGEEIVLTGWGSDVAYGSSMEDLHKLTVG 179

  Fly   193 HVVYSTCQEIMNNDPSNGPCHICTLTTGGQGACHGDSGGPLTHNGVLYGLVNWGYPCALGVPDSH 257
            .|....|.|..|...|.|..||||.:..|:|||||||||||..||.|.|:||||.||.:|:||..
  Fly   180 LVPLDECYETFNRTSSMGVGHICTFSREGEGACHGDSGGPLVSNGQLVGVVNWGRPCGVGLPDVQ 244

  Fly   258 ANVYYYLEWIRSMISGPCSNCHCY 281
            |||||||:||||.:||   |..||
  Fly   245 ANVYYYLDWIRSKLSG---NNKCY 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 107/217 (49%)
Tryp_SPc 50..269 CDD:238113 108/218 (50%)
CG31265NP_650599.1 Tryp_SPc 36..254 CDD:214473 107/217 (49%)
Tryp_SPc 39..257 CDD:238113 109/217 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BRU4
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D104368at6960
OrthoFinder 1 1.000 - - FOG0007620
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.