DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17475 and modSP

DIOPT Version :9

Sequence 1:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_536776.2 Gene:modSP / 42032 FlyBaseID:FBgn0051217 Length:628 Species:Drosophila melanogaster


Alignment Length:200 Identity:53/200 - (26%)
Similarity:77/200 - (38%) Gaps:50/200 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 GMYGGH-------ICGGCIIDERHVLTAAHCVYG------YNPTYLRVITG--------TVEYEK 112
            |:|..|       .|||.::....|:|||||||.      |:....|||..        |...||
  Fly   385 GLYVWHNEKDYHFQCGGSLLTPDLVITAAHCVYDEGTRLPYSYDTFRVIAAKFYRNYGETTPEEK 449

  Fly   113 PDAVYFVEEHWIHCNY--NSPDYHNDIALIRLNDTIKFNEYTQPAELPTA------PVANGTQLL 169
            ...|..:|   |...|  .:.:|:.|:||:.|::..:.:...:|..:..|      .|.:..|..
  Fly   450 RRDVRLIE---IAPGYKGRTENYYQDLALLTLDEPFELSHVIRPICVTFASFAEKESVTDDVQGK 511

  Fly   170 LTGWGSTELWGDTPDILQKAYLTHV-----VYSTCQEIMNNDPSNGPCHICTLTTGGQGACHGDS 229
            ..||          :|..|..|..|     ..|.|:..:.:..::   ..|..|.|...||.|||
  Fly   512 FAGW----------NIENKHELQFVPAVSKSNSVCRRNLRDIQAD---KFCIFTQGKSLACQGDS 563

  Fly   230 GGPLT 234
            ||..|
  Fly   564 GGGFT 568

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 52/199 (26%)
Tryp_SPc 50..269 CDD:238113 52/199 (26%)
modSPNP_536776.2 LDLa 27..58 CDD:197566
LDLa 70..101 CDD:197566
LDLa 123..157 CDD:197566
LDLa 167..199 CDD:238060
CCP <251..284 CDD:153056
Sushi 309..354 CDD:278512
Tryp_SPc 371..616 CDD:214473 52/199 (26%)
Tryp_SPc 371..591 CDD:304450 52/199 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468806
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.