DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17475 and CG10405

DIOPT Version :9

Sequence 1:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_001036717.1 Gene:CG10405 / 41996 FlyBaseID:FBgn0038431 Length:268 Species:Drosophila melanogaster


Alignment Length:256 Identity:74/256 - (28%)
Similarity:110/256 - (42%) Gaps:62/256 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 NRVINGEDVQLGEAKYQISLQGMYGGHICGGCIIDERHVLTAAHCVYGYNP----------TYLR 102
            :|::||.:...|:..||:||: ....||||..|:.....:|||||:.|:..          :.:|
  Fly    35 SRIVNGREATEGQFPYQLSLR-RQTVHICGASILSSNWAITAAHCIDGHEQQPREFTLRQGSIMR 98

  Fly   103 VITGTVEYEKPDAVYFVEEHWIHCNYNSPDYHNDIALIRLND---TIKFNEYTQPAELPTA--PV 162
            ...|||:..|  |:|      .|..|:..|.:.|:||:|..|   ::...: ..|..|||.  .:
  Fly    99 TSGGTVQPVK--AIY------KHPAYDRADMNFDVALLRTADGALSLPLGK-VAPIRLPTVGEAI 154

  Fly   163 ANGTQLLLTGWG--STELWGDTPDILQKAYLTHVVYSTCQEIMNNDPSNGPCHICTLTTGG---- 221
            :.....:::|||  ||          ....|:.|:.||....:|.:    .||......||    
  Fly   155 SESMPAVVSGWGHMST----------SNPVLSSVLKSTTVLTVNQE----KCHNDLRHHGGVTEA 205

  Fly   222 --------QGACHGDSGGPLTHNGVLYGLVNWGYPCALGVPDSHANVYYYL------EWIR 268
                    ..||.||||||::..|.|.|:|:||..||   ...:..||..|      .|||
  Fly   206 MFCAAARNTDACQGDSGGPISAQGTLIGIVSWGVGCA---DPYYPGVYTRLAHPTIRRWIR 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 71/252 (28%)
Tryp_SPc 50..269 CDD:238113 73/254 (29%)
CG10405NP_001036717.1 Tryp_SPc 36..262 CDD:214473 71/252 (28%)
Tryp_SPc 37..263 CDD:238113 71/252 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.