DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17475 and Klk4

DIOPT Version :9

Sequence 1:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_001004101.1 Gene:Klk4 / 408210 RGDID:1303228 Length:256 Species:Rattus norvegicus


Alignment Length:252 Identity:71/252 - (28%)
Similarity:118/252 - (46%) Gaps:36/252 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 ISKAEGVNFQNRVINGEDVQLGEAKYQISLQGMYGGHICGGCIIDERHVLTAAHCVYGYNPTY-- 100
            ::.:...:..:|:|.|:|.......:|.:|........|.|.::..:.||:||||:   ..:|  
  Rat    20 VTGSSASSISSRIIQGQDCLPHSQPWQAALFSEDNAFFCSGVLVHPQWVLSAAHCI---QDSYTV 81

  Fly   101 ---LRVITGTVEYEKPDAVYFVEEHWI--HCNYNSPDYHNDIALIRLNDTIKFNEYTQPAELPTA 160
               |..:.|:   ::|.: ..:|.|..  |.|||.|.:.||:.||:||:::     .:...:...
  Rat    82 GLGLHNLEGS---QEPGS-RMLEAHLSIQHPNYNDPSFANDLMLIKLNESV-----MESNTIRRI 137

  Fly   161 PVAN-----GTQLLLTGWGSTELWGDTPDILQKAYLTHVVYSTCQEIMNNDPSNGPCHICTLTTG 220
            |||:     |...|::|||..:. |..|.:||...|:.....||:.:.  ||   ..|:.....|
  Rat   138 PVASQCPTPGDTCLVSGWGRLKN-GKLPSLLQCVNLSVASEETCRLLY--DP---VYHLSMFCAG 196

  Fly   221 G----QGACHGDSGGPLTHNGVLYGLVNWGY-PCAL-GVPDSHANVYYYLEWIRSMI 271
            |    :..|:||||||:..|..|.|||:.|. .|.. |:|..:.|:..:..||.:.|
  Rat   197 GGPDRKDTCNGDSGGPIVCNRSLQGLVSMGQGECGQPGIPSVYTNLCKFTNWIWTTI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 68/235 (29%)
Tryp_SPc 50..269 CDD:238113 69/236 (29%)
Klk4NP_001004101.1 Tryp_SPc 35..249 CDD:238113 66/231 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.