DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17475 and MP1

DIOPT Version :9

Sequence 1:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_001303421.1 Gene:MP1 / 40541 FlyBaseID:FBgn0027930 Length:400 Species:Drosophila melanogaster


Alignment Length:269 Identity:88/269 - (32%)
Similarity:121/269 - (44%) Gaps:41/269 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 GVNFQNRVINGEDVQLGE----AKYQISLQGMYGGHICGGCIIDERHVLTAAHCVYGY------- 96
            |.||.:||:.|.:....|    |..:.:..|...||.|||.:|:.|:||||||||...       
  Fly   131 GENFGDRVVGGNETTKREFPWMALIEYTKPGNVKGHHCGGSLINHRYVLTAAHCVSAIPSDWELT 195

  Fly    97 -----------NPTYLRVITGTVEYEKPDAVYFVEEHWIHCNY--NSPDYHNDIALIRLNDTIKF 148
                       ||.......|..:..:|...|.|||...|..|  ||.|..|||||:||.|.:::
  Fly   196 GVRLGEWDASTNPDCTVGKNGRRDCNEPYVDYPVEERIPHPQYPGNSRDQLNDIALLRLRDEVQY 260

  Fly   149 NEYTQPAELPTAP-----VANGTQLLLTGWGSTELWGDTPDILQKAYLTHVVYSTC-QEIMNNDP 207
            :::..|..|||..     :..|.::::.|||.||. ..|.:|..||.|..|..|.| |.......
  Fly   261 SDFILPVCLPTLASQHNNIFLGRKVVVAGWGRTET-NFTSNIKLKAELDTVPTSECNQRYATQRR 324

  Fly   208 SNGPCHICTLTTGGQGACHGDSGGPL--------THNGVLYGLVNWG-YPCAL-GVPDSHANVYY 262
            :.....:|.....|..:|.|||||||        ..|..:.|:|::| .||.| |.|..:..|..
  Fly   325 TVTTKQMCAGGVEGVDSCRGDSGGPLLLEDYSNGNSNYYIAGVVSYGPTPCGLKGWPGVYTRVEA 389

  Fly   263 YLEWIRSMI 271
            ||.||.:.:
  Fly   390 YLNWIENNV 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 83/257 (32%)
Tryp_SPc 50..269 CDD:238113 84/258 (33%)
MP1NP_001303421.1 CLIP 29..91 CDD:288855
Tryp_SPc 137..394 CDD:214473 83/257 (32%)
Tryp_SPc 138..397 CDD:238113 84/259 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437259
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.