DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17475 and CG18223

DIOPT Version :9

Sequence 1:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_649077.1 Gene:CG18223 / 40068 FlyBaseID:FBgn0036832 Length:322 Species:Drosophila melanogaster


Alignment Length:264 Identity:68/264 - (25%)
Similarity:105/264 - (39%) Gaps:62/264 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 AKYQISLQG-----MYG-GHICGGCIIDERHVLTAAHCVYG-----YNPTYLRVITGT------- 107
            |||.:|::.     ::| .|.|||.||...::||:|||...     :....|.|:.||       
  Fly    58 AKYVVSIRSRRPHKLFGDNHFCGGVIISRTYILTSAHCAMDKRKIVHRSRVLVVVAGTTNRLKSR 122

  Fly   108 ------VEYEKPDAVYFVEEHWIHCNYNSPDYHNDIALIRLNDTIKF-NEYTQPAELPTAPVANG 165
                  :|.:|    .||.:.:...|      .|:|||:.|...:.. |.......||||....|
  Fly   123 KGLSLNMEVKK----IFVPDKFTVFN------TNNIALMMLAKKLPLDNPLVGVINLPTADPEPG 177

  Fly   166 TQLLLTGWGSTELWGDTP-------------DILQKAYLTHVVYSTCQEIMNNDPSNGPCHICTL 217
            ....:.|||.....|...             ||.:|..........|...:||.....|      
  Fly   178 LNYTVLGWGRIFKGGPLASDILHIDVELLPRDICEKKVHIFKEEMMCAGNLNNTMDENP------ 236

  Fly   218 TTGGQGACHGDSGGPLTHNGVLYGLVNWGYPC-ALGVPDSHANVYYYLEWIRSMISGPCSNCHCY 281
                   |.||:|.||..|..::|:|::...| :..:|..:.|||.:::||..:::...:|..||
  Fly   237 -------CAGDTGSPLIFNETVFGVVSYRVGCGSKTLPSIYTNVYMHMDWINGIMNNNEANRLCY 294

  Fly   282 ASNY 285
            :.||
  Fly   295 SPNY 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 61/244 (25%)
Tryp_SPc 50..269 CDD:238113 63/246 (26%)
CG18223NP_649077.1 Tryp_SPc 60..283 CDD:238113 61/245 (25%)
Tryp_SPc 60..280 CDD:214473 59/242 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468800
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.