DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17475 and CG11529

DIOPT Version :9

Sequence 1:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_648558.1 Gene:CG11529 / 39395 FlyBaseID:FBgn0036264 Length:287 Species:Drosophila melanogaster


Alignment Length:238 Identity:70/238 - (29%)
Similarity:108/238 - (45%) Gaps:32/238 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 LGEAK--------YQISLQG--MYGGHI-CGGCIIDERHVLTAAHCVYGYNPTYLRVITGTVEYE 111
            :|::|        ||:.|.|  ::...| |||.::|:|.:|||.||..|.  |:..|..||...|
  Fly    30 VGQSKYGRIEKFPYQVMLIGKQLWRKRILCGGTLLDKRWILTAGHCTMGV--THYDVYLGTKSVE 92

  Fly   112 KPDA----VYFVEEHWIHCNYNSPDYHNDIALIRLNDTIKFNEYTQPAELPTA---PVANGTQLL 169
            ..:.    |....:..:|..:|.....|||||::|...:.|....|||.||:.   ....|..::
  Fly    93 DTEVSGGLVLRSNKFIVHERFNPETAANDIALVKLPQDVAFTPRIQPASLPSRYRHDQFAGMSVV 157

  Fly   170 LTGWGS-TELWGDTPDILQKAYLTHVVYSTCQEIMNNDPSNGPCHICTLTTGGQGACHGDSGGPL 233
            .:|||: .|:  ...|.:|...|..:..:.|.:..:...|.   .||......:..|.|||||||
  Fly   158 ASGWGAMVEM--TNSDSMQYTELKVISNAECAQEYDVVTSG---VICAKGLKDETVCTGDSGGPL 217

  Fly   234 T--HNGVLYGLVNWGYP---CALGVPDSHANVYYYLEWIRSMI 271
            .  ...::.|:.::| |   |...:|.....|.:||:||.|.|
  Fly   218 VLKDTQIVVGITSFG-PADGCETNIPGGFTRVTHYLDWIESKI 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 66/232 (28%)
Tryp_SPc 50..269 CDD:238113 68/234 (29%)
CG11529NP_648558.1 Tryp_SPc 37..258 CDD:238113 66/228 (29%)
Tryp_SPc 37..255 CDD:214473 64/225 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.