DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17475 and CG8329

DIOPT Version :9

Sequence 1:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_648339.1 Gene:CG8329 / 39123 FlyBaseID:FBgn0036022 Length:259 Species:Drosophila melanogaster


Alignment Length:251 Identity:72/251 - (28%)
Similarity:99/251 - (39%) Gaps:66/251 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 VINGEDVQLGEAKYQISLQGMYGGHICGGCIIDERHVLTAAHCV--------YGYNPTYLRVITG 106
            ::||.....|:|.|.:.|: |..|.:.||.:|....|||||||:        ||.|    |...|
  Fly    35 IVNGYPAYEGKAPYAVGLR-MNNGAVGGGSVIGNNWVLTAAHCLTTDSVTIHYGSN----RAWNG 94

  Fly   107 TVEYEKPDAVYFVEEHWIHCN--YNSPDYHN----DIALIRLNDTIKFNEYTQPAELPTAPVANG 165
            .:            :|.::.|  :..|.|.|    ||.||| ...:.|........||... ..|
  Fly    95 QL------------QHTVNKNNFFRHPGYPNSAGHDIGLIR-TPYVSFTNLINKVSLPKFS-QKG 145

  Fly   166 TQL-----LLTGWGSTELWGDTPDILQKAYLTHVVYSTCQEIMNNDPSNGPC----------HIC 215
            .:.     :..|||.... |...|.||           |.::  ...|||.|          .:|
  Fly   146 ERFENWWCVACGWGGMAN-GGLADWLQ-----------CMDV--QVISNGECARSYGSVASTDMC 196

  Fly   216 TLTTGGQGACHGDSGGPL-TH-NGVLYGLVNW-GYPCALGVPDSHANVYYYLEWIR 268
            |..|.|:..|.|||||.| || |.:..|::.: ...|..| |..:..|..:|:|||
  Fly   197 TRATDGKSVCGGDSGGALVTHDNPIQVGVITFASIGCKSG-PSGYTRVSDHLDWIR 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 69/248 (28%)
Tryp_SPc 50..269 CDD:238113 72/251 (29%)
CG8329NP_648339.1 Tryp_SPc 35..253 CDD:238113 72/251 (29%)
Tryp_SPc 35..250 CDD:214473 69/248 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436804
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.