DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17475 and CG33460

DIOPT Version :9

Sequence 1:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_001033949.1 Gene:CG33460 / 3885588 FlyBaseID:FBgn0053460 Length:275 Species:Drosophila melanogaster


Alignment Length:226 Identity:51/226 - (22%)
Similarity:88/226 - (38%) Gaps:49/226 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 GGHICGGCIIDERHVLTAAHCVYGYNPTYLRVITGTVEYEK-PDAVYFVEEHWIHC-----NYNS 130
            |...|.|.:|.:..:||||.|:   .|..::|..|  |:.: |:.:  .|:|.:|.     .:|:
  Fly    53 GSIFCAGTLITDVFILTAASCI---RPNAVKVRLG--EFGRYPNEL--PEDHLVHYFLMYRLFNN 110

  Fly   131 PDYHNDIALIRLNDTIKFNEYTQPAELPTAPVANGTQLLLTGWGSTELWGDTPDI-LQKAYLTHV 194
            ....|:|.|::|...::..:|..|..:...|   ..|.|.|.......|.:..:: |.|.....|
  Fly   111 ESLANNIGLLKLTKRVQITDYIMPVCIVLNP---QNQQLSTMRFIGNAWMEDSNVSLTKELRPIV 172

  Fly   195 VYSTCQEIMNNDPSNGPCHICTLTTGGQG---ACHGDSGGPLTHNG--------VLYGLVNWGYP 248
            :.|..:...|.|.....|      .|.||   :|.|.:|..|..|.        :.:|:..    
  Fly   173 IQSKPKMCTNLDLYTQFC------AGHQGNLRSCDGLTGSALIQNSRYMNKYRHIQFGIAT---- 227

  Fly   249 CALGVPD-------SHANVYYYLEWIRSMIS 272
                |.|       .:.:|..:..||:.::|
  Fly   228 ----VNDMDCEESQGYTDVLKFYWWIQDVVS 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 48/219 (22%)
Tryp_SPc 50..269 CDD:238113 50/221 (23%)
CG33460NP_001033949.1 Tryp_SPc 44..252 CDD:304450 50/222 (23%)
Tryp_SPc 44..249 CDD:214473 48/219 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437313
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.