DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17475 and CG10472

DIOPT Version :9

Sequence 1:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_648017.1 Gene:CG10472 / 38688 FlyBaseID:FBgn0035670 Length:290 Species:Drosophila melanogaster


Alignment Length:306 Identity:95/306 - (31%)
Similarity:131/306 - (42%) Gaps:64/306 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 ACTCYKPISAVRLAQLSEDQLEWIS-----------KAEGVNF-QNRVINGEDVQLGEAKYQISL 67
            ||.....::.:    |....::|.|           |..|... ..|:..|:..:..:..||:.|
  Fly     4 ACATVLLLATI----LGAQAVDWNSVKNLNIETPMPKVHGETLPSGRITGGQIAEPNQFPYQVGL 64

  Fly    68 QGMY---GGHICGGCIIDERHVLTAAHCVYGYN---PTYLRVITGTVEYEKPDAVYFVE------ 120
            . :|   |...|||.||.:|.::|||||.....   ..||.....|...|:...:.|||      
  Fly    65 L-LYITGGAAWCGGTIISDRWIITAAHCTDSLTTGVDVYLGAHDRTNAKEEGQQIIFVETKNVIV 128

  Fly   121 -EHWIHCNYNSPDYHNDIALIRLNDTIKFNEYTQPAELP----TAPVANGTQLLLTGWG--STEL 178
             |.||     :....|||:||:|...|:||:|.|||:||    :.....|...:.:|||  |...
  Fly   129 HEDWI-----AETITNDISLIKLPVPIEFNKYIQPAKLPVKSDSYSTYGGENAIASGWGKISDSA 188

  Fly   179 WGDTPDILQKAYLTHVVYSTCQEIMNNDPSN-------GPCHICTLTTGGQGACHGDSGGPLT-- 234
            .|.| ||||        |:|. .||||...:       ...:||..||||...|:|||||||.  
  Fly   189 TGAT-DILQ--------YATV-PIMNNSGCSPWYFGLVAASNICIKTTGGISTCNGDSGGPLVLD 243

  Fly   235 -HNGVLYGLVNWGYP--CALGVPDSHANVYYYLEWIRSMISGPCSN 277
             .:..|.|..::|..  |.:|.|.....:.|||:||... ||..:|
  Fly   244 DGSNTLIGATSFGIALGCEVGWPGVFTRITYYLDWIEEK-SGVVNN 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 83/248 (33%)
Tryp_SPc 50..269 CDD:238113 84/249 (34%)
CG10472NP_648017.1 Tryp_SPc 46..279 CDD:214473 83/248 (33%)
Tryp_SPc 47..282 CDD:238113 84/250 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436876
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.