DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17475 and Jon65Ai

DIOPT Version :9

Sequence 1:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_001286951.1 Gene:Jon65Ai / 38685 FlyBaseID:FBgn0035667 Length:262 Species:Drosophila melanogaster


Alignment Length:295 Identity:79/295 - (26%)
Similarity:111/295 - (37%) Gaps:73/295 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VQILVILLACTCYKPISAVRLAQLSEDQLEW----ISKAEGVNFQNRVINGEDVQLGEAKYQISL 67
            :::|.:||       :..:..|...|..:.|    :.||   :.:.|:..|.....|:..|.:.|
  Fly     1 MKVLAVLL-------LGVIASATAFEKPVFWKDVPVGKA---SIEGRITMGYPAYEGKVPYIVGL 55

  Fly    68 ----QGMYGGHICGGCIIDERHVLTAAHCVYGYNPTYLRVITGTVEYE---KPDAVYFVEEHWIH 125
                .|  ||..|||.||....|:||.||..|....       |:.|.   :..|.|   .||: 
  Fly    56 GFSKNG--GGTWCGGSIIGNTWVMTAKHCTDGMESV-------TIYYGALWRLQAQY---THWV- 107

  Fly   126 CNYNSPDY----HNDIALIRLNDTIKFNEYTQPAELPTAPVA----NGTQLLLTGWGSTELWGDT 182
               ...|:    ..||:||| ...:.|.......|||.....    .|...|::|||.|...|..
  Fly   108 ---GRSDFIEHGSGDISLIR-TPHVDFWSLVNKVELPRYDDRYNNYQGWWALVSGWGKTSDEGGV 168

  Fly   183 PDILQKAYLTHVVYSTCQEIMNNDPSNGPCH----------ICTLTTGGQGACHGDSGGPLT-HN 236
            .:           |..|.::...:  |..|.          ||..|...:|.|.|||||||. |:
  Fly   169 SE-----------YLNCVDVQIGE--NSVCENYYGSFSGDLICIPTPENKGTCSGDSGGPLVIHD 220

  Fly   237 G-VLYGLVNWGYP--CALGVPDSHANVYYYLEWIR 268
            | ...|:|::|..  |....|.....|..||:|||
  Fly   221 GNRQVGIVSFGSSAGCLSNGPKGMVRVTSYLDWIR 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 68/246 (28%)
Tryp_SPc 50..269 CDD:238113 70/248 (28%)
Jon65AiNP_001286951.1 Tryp_SPc 37..254 CDD:214473 68/246 (28%)
Tryp_SPc 41..257 CDD:238113 70/245 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436750
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.