DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17475 and CG10477

DIOPT Version :9

Sequence 1:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_001303385.1 Gene:CG10477 / 38679 FlyBaseID:FBgn0035661 Length:272 Species:Drosophila melanogaster


Alignment Length:251 Identity:72/251 - (28%)
Similarity:102/251 - (40%) Gaps:45/251 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 NFQNRVINGEDVQLGEAKYQI--SLQGMYGGHICGGCIIDERHVLTAAHCVYG-------YNPTY 100
            :...|:.||......:..||:  |.:...|...|||.||....|||||||..|       |..| 
  Fly    35 SIDGRITNGNKAAANQFPYQVGLSFKSSAGSWWCGGSIIANTWVLTAAHCTKGASSVTIYYGST- 98

  Fly   101 LRVITGTVEYEKPDAVYFVEEHWIHCNYNSPDYHNDIALIR---LNDTIKFNEYTQPAELPTAPV 162
              |.|.....:|..:..||:    |..||:....|||:||:   :..|:..|:...||...:...
  Fly    99 --VRTSAKLKKKVSSSKFVQ----HAGYNAATLRNDISLIKTPSVTFTVSINKIALPAIASSYST 157

  Fly   163 ANGTQLLLTGWGSTELWGDTPDILQKAYLTHVVYSTCQEIMNNDPSNGPCH------------IC 215
            ..|...:.:|||.|   .|:    ..|..|::.|:..|.|     :|..|.            ||
  Fly   158 YAGQTAVASGWGRT---SDS----SIAVATNLQYAQFQVI-----TNAVCQKTFGSSVVTSGVIC 210

  Fly   216 TLTTGGQGACHGDSGGPLTHNGVLYGLVNW--GYPCALGVPDSHANVYYYLEWIRS 269
            ..:...:..|.|||||||..|..|.|:.::  ...|....|.....|..||:||::
  Fly   211 VESINKKSTCQGDSGGPLALNNRLIGVTSFVSSKGCEKNAPAGFTRVTSYLDWIKN 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 70/243 (29%)
Tryp_SPc 50..269 CDD:238113 71/244 (29%)
CG10477NP_001303385.1 Tryp_SPc 39..264 CDD:214473 70/243 (29%)
Tryp_SPc 40..267 CDD:238113 71/246 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436858
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.