DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17475 and CG8299

DIOPT Version :9

Sequence 1:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster


Alignment Length:239 Identity:72/239 - (30%)
Similarity:119/239 - (49%) Gaps:19/239 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 EGVNFQNRVINGEDVQLGEAKYQIS--LQGMYGGHICGGCIIDERHVLTAAHCVYGYNPTYLRVI 104
            :..:....::.|:...:.:..||:|  |:.....|||||.|...|.|:|||||:.|...:|:|::
  Fly    20 DSASISTHIVGGDQADIADFPYQVSVRLETYMLLHICGGSIYAPRVVITAAHCIKGRYASYIRIV 84

  Fly   105 TGTVEYEKPDAVYFVEEHWI-------HCNYNSPDYHNDIALIRLNDTIKFNEYTQPAELPTAPV 162
            .|      .:::..:||..:       |..||...|.|||.||...:.::::...||..:.....
  Fly    85 AG------QNSIADLEEQGVKVSKLIPHAGYNKKTYVNDIGLIITREPLEYSALVQPIAVALEAP 143

  Fly   163 ANGTQLLLTGWGS-TELWGDTPDILQKAYLTHVVYSTC-QEIMNNDPSNGPCHICT-LTTGGQGA 224
            .:|.|.:::|||. .|.....|.:|:...|..:..||| .:.:..|.:.....:|. ...||:..
  Fly   144 PSGAQAVVSGWGKRAEDDEALPAMLRAVELQIIEKSTCGAQYLTKDYTVTDEMLCAGYLEGGKDT 208

  Fly   225 CHGDSGGPLTHNGVLYGLVNWGYPCAL-GVPDSHANVYYYLEWI 267
            |:|||||||..:|||.|:|:||..|.. |.|..:.:|..:::||
  Fly   209 CNGDSGGPLAVDGVLVGVVSWGVGCGREGFPGVYTSVNSHIDWI 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 70/230 (30%)
Tryp_SPc 50..269 CDD:238113 72/231 (31%)
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 70/230 (30%)
Tryp_SPc 28..255 CDD:238113 72/231 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.