DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17475 and iotaTry

DIOPT Version :9

Sequence 1:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_523695.1 Gene:iotaTry / 36223 FlyBaseID:FBgn0015001 Length:252 Species:Drosophila melanogaster


Alignment Length:270 Identity:81/270 - (30%)
Similarity:124/270 - (45%) Gaps:28/270 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVRLGVVQILVILLACTCYKPISAVRLAQLSEDQLEWISKAEGVNFQNRVINGEDVQLGEAKYQI 65
            |...|:|..:::||.                      :..|..|....|:|.|.|..:..|.:|:
  Fly     1 MAVYGIVATVLVLLL----------------------LGDASDVEATGRIIGGSDQLIRNAPWQV 43

  Fly    66 SLQGMYGGHICGGCIIDERHVLTAAHCVYGYNPTYLRVITGTVEYEKPDAVYFVEEHWIHCNYNS 130
            |:| :...|.|||.|..:..::||.||::..:.|.::|..|...:.....:..|..:.:|..::|
  Fly    44 SIQ-ISARHECGGVIYSKEIIITAGHCLHERSVTLMKVRVGAQNHNYGGTLVPVAAYKVHEQFDS 107

  Fly   131 PDYHNDIALIRLNDTIKFNEYTQPAELPTAPVANGTQLLLTGWGSTELWGDTPDILQKAYLTHVV 195
            ...|.|||::||:..:.|...|:...|.:...:.||.:.:||||.|:. |...|.||||.|..:.
  Fly   108 RFLHYDIAVLRLSTPLTFGLSTRAINLASTSPSGGTTVTVTGWGHTDN-GALSDSLQKAQLQIID 171

  Fly   196 YSTC--QEIMNNDPSNGPCHICTLTTGGQGACHGDSGGPLTHNGVLYGLVNWGYPCA-LGVPDSH 257
            ...|  |:........|...||..:|... ||.|||||||..:..|.|:|:|||.|| ...|..:
  Fly   172 RGECASQKFGYGADFVGEETICAASTDAD-ACTGDSGGPLVASSQLVGIVSWGYRCADDNYPGVY 235

  Fly   258 ANVYYYLEWI 267
            |:|.....||
  Fly   236 ADVAILRPWI 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 72/220 (33%)
Tryp_SPc 50..269 CDD:238113 73/221 (33%)
iotaTryNP_523695.1 Tryp_SPc 27..245 CDD:214473 72/220 (33%)
Tryp_SPc 28..247 CDD:238113 73/221 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.