DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17475 and etaTry

DIOPT Version :9

Sequence 1:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_523692.1 Gene:etaTry / 36217 FlyBaseID:FBgn0011554 Length:262 Species:Drosophila melanogaster


Alignment Length:274 Identity:87/274 - (31%)
Similarity:127/274 - (46%) Gaps:36/274 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VVQILVILLACTCYKPISAVRLAQLSEDQLEWISKAEGVNFQNRVINGEDVQLGEAKYQISLQ-- 68
            :::||.:|.....| .:||               :::|     |::.|.|......||.:.|:  
  Fly     5 ILRILAVLFLLGIY-AVSA---------------QSDG-----RIVGGADTSSYYTKYVVQLRRR 48

  Fly    69 ----GMYGGHICGGCIIDERHVLTAAHCVYGYNPTYLRVITGTVEYEKPDAVYF-VEEHWIHCNY 128
                ..| ...|||||:|...:.|||||||........|:.|.......:.|.. |.:...|..|
  Fly    49 SSSSSSY-AQTCGGCILDAVTIATAAHCVYNREAENFLVVAGDDSRGGMNGVVVRVSKLIPHELY 112

  Fly   129 NSPDYHNDIALIRLNDTIKFNEYT--QPAELPTAPVANGTQLLLTGWGSTELWGDTPDILQKAYL 191
            ||....|||||:.::..:..:.::  :..|:.:...|.|.|..::|||.|:..|.:.|.||:..:
  Fly   113 NSSTMDNDIALVVVDPPLPLDSFSTMEAIEIASEQPAVGVQATISGWGYTKENGLSSDQLQQVKV 177

  Fly   192 THVVYSTCQEIMNNDP-SNGPCHICT-LTTGGQGACHGDSGGPLTHNGVLYGLVNWGYPCAL-GV 253
            ..|....|||.....| |.|  .:|. |:.||:.||.|||||||.....|.|:|:||..||. ..
  Fly   178 PIVDSEKCQEAYYWRPISEG--MLCAGLSEGGKDACQGDSGGPLVVANKLAGIVSWGEGCARPNY 240

  Fly   254 PDSHANVYYYLEWI 267
            |..:|||.||.:||
  Fly   241 PGVYANVAYYKDWI 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 78/229 (34%)
Tryp_SPc 50..269 CDD:238113 79/230 (34%)
etaTryNP_523692.1 Tryp_SPc 27..254 CDD:214473 78/229 (34%)
Tryp_SPc 28..257 CDD:238113 79/230 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.