Sequence 1: | NP_001287372.1 | Gene: | CG17475 / 42069 | FlyBaseID: | FBgn0038481 | Length: | 288 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001021891.1 | Gene: | try-9 / 3565941 | WormBaseID: | WBGene00023425 | Length: | 279 | Species: | Caenorhabditis elegans |
Alignment Length: | 269 | Identity: | 61/269 - (22%) |
---|---|---|---|
Similarity: | 89/269 - (33%) | Gaps: | 93/269 - (34%) |
- Green bases have known domain annotations that are detailed below.
Fly 38 ISKAEGV--NFQNRVINGEDVQLGEAKYQISLQGMYGGHICGGCIIDERHVLTAAHCVYGYNPTY 100
Fly 101 LRVITGTVEYEKPDA-------VYFVEEH----------------------------------WI 124
Fly 125 HCNYNSP-----DYHNDIALIRLNDTIKFNEYTQPAELPTAPV---ANGTQLLLTGWGSTELWGD 181
Fly 182 TPDILQKAYLTHVVYSTCQEIMNNDPSNGPCHICTLTTGGQGACHGDSGGPLTHNG------VLY 240
Fly 241 GLVNWGYPC 249 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG17475 | NP_001287372.1 | Tryp_SPc | 49..267 | CDD:214473 | 56/256 (22%) |
Tryp_SPc | 50..269 | CDD:238113 | 56/255 (22%) | ||
try-9 | NP_001021891.1 | Tryp_SPc | 30..237 | CDD:389826 | 50/225 (22%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |