DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17475 and try-9

DIOPT Version :9

Sequence 1:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_001021891.1 Gene:try-9 / 3565941 WormBaseID:WBGene00023425 Length:279 Species:Caenorhabditis elegans


Alignment Length:269 Identity:61/269 - (22%)
Similarity:89/269 - (33%) Gaps:93/269 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 ISKAEGV--NFQNRVINGEDVQLGEAKYQISLQGMYGGHICGGCIIDERHVLTAAHCVYGYNPTY 100
            ||...|.  |..|:....|.||.|.                 |.::...|::||||.:       
 Worm     5 ISDGSGSFRNGGNKFSENEFVQHGT-----------------GTLVSPWHIVTAAHLI------- 45

  Fly   101 LRVITGTVEYEKPDA-------VYFVEEH----------------------------------WI 124
                 |..|...||.       .|||.::                                  :|
 Worm    46 -----GISEDPLPDCDTGNLREAYFVRDYKNFVAFVNVTCAVPEMCKGLHRKDMFKPLAIKSLYI 105

  Fly   125 HCNYNSP-----DYHNDIALIRLNDTIKFNEYTQPAELPTAPV---ANGTQLLLTGWGSTELWGD 181
            ...|...     :..||||:..|.:.|:|::...||.||:||.   ...|...|.|:|.     |
 Worm   106 RKGYVGDGCIDRESFNDIAVFELEEPIEFSKDIFPACLPSAPKIPRIRETGYKLFGYGR-----D 165

  Fly   182 TPDILQKAYLTHVVYSTCQEIMNNDPSNGPCHICTLTTGGQGACHGDSGGPLTHNG------VLY 240
            ..|.:.::.....:||...|..::.|..|.  .||.......:|.||||..:....      ||.
 Worm   166 PSDSVLESGKLKSLYSFVAECSDDFPYGGV--YCTSAVNRGLSCDGDSGSGVVRTSDTRNVQVLV 228

  Fly   241 GLVNWGYPC 249
            |:::.|.||
 Worm   229 GVLSAGMPC 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 56/256 (22%)
Tryp_SPc 50..269 CDD:238113 56/255 (22%)
try-9NP_001021891.1 Tryp_SPc 30..237 CDD:389826 50/225 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.