DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17475 and CG17572

DIOPT Version :9

Sequence 1:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_609941.2 Gene:CG17572 / 35182 FlyBaseID:FBgn0032753 Length:385 Species:Drosophila melanogaster


Alignment Length:308 Identity:76/308 - (24%)
Similarity:128/308 - (41%) Gaps:63/308 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LVILLACTCYKPISAVRLAQLSEDQLEWISKAEGVNFQNRVINGEDVQ------LGEAKY--QIS 66
            |:..:|.:||....::.....|| :|.::........:|:|.....||      ||...:  :|.
  Fly    84 LIYEVARSCYYGDKSLYCGGSSE-ELPYVCCPSSPLEKNQVCGKSLVQGHFYKGLGSYPFVARIG 147

  Fly    67 LQGMYGG---HICGGCIIDERHVLTAAHCVY----GYNPTYLRVITGTVEYE---KPDAV----- 116
            .:.:..|   :.|.|.:|..|.:||||||..    |:..:.:||    .||:   .||..     
  Fly   148 FKHVNTGAFAYPCAGAVIARRVILTAAHCALAKADGHRLSSVRV----GEYDTSSDPDCANTGFC 208

  Fly   117 ------YFVEEHWIHCNYNSPDYHNDIALIRLNDTIKFNEYTQP--AELPTAPVANGTQLLLTGW 173
                  :.:....:|.:|....||:||||:.|...:.::..|||  .:...|.:..|.:..:.||
  Fly   209 APRSVNHAISHVIVHPDYKQGQYHHDIALLVLKTPLNYSVATQPICLQKTRANLVVGKRATIAGW 273

  Fly   174 GSTELWGDTPDILQKAYLTH--VVYSTCQEIMNNDPSNGPCH---------ICTLTTGGQG--AC 225
            |..    .|..:.|.. ::|  |..::....:.|..|.|...         :|   .||:|  .|
  Fly   274 GKM----STSSVRQPE-MSHLDVPLTSWDLCLRNYGSTGALESPNSIEGQWMC---AGGEGKDVC 330

  Fly   226 HGDSGGPL--THNGVL--YGLVNWGYP-C-ALGVPDSHANVYYYLEWI 267
            .|..|.||  ..||:.  .|::::|.. | .|.:|..:.:|.::.|||
  Fly   331 QGFGGAPLFIQENGIFSQIGIMSFGSDNCGGLRIPSVYTSVAHFSEWI 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 66/267 (25%)
Tryp_SPc 50..269 CDD:238113 68/268 (25%)
CG17572NP_609941.2 Tryp_SPc 138..381 CDD:238113 64/253 (25%)
Tryp_SPc 138..378 CDD:214473 62/251 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.