DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17475 and Send1

DIOPT Version :9

Sequence 1:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_608662.1 Gene:Send1 / 33407 FlyBaseID:FBgn0031406 Length:255 Species:Drosophila melanogaster


Alignment Length:281 Identity:78/281 - (27%)
Similarity:120/281 - (42%) Gaps:52/281 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 CYKPISAVRLAQLSEDQLEWISKAEGVNFQ--NRVINGEDVQLGEAKYQISLQGMYGGHICGGCI 80
            |:..:.||.|.         ||....|..:  .|:|.|..:.:.:..:|:||| .||.|.|||.|
  Fly     5 CFHLLLAVHLL---------ISPVVPVLLEPSERIIGGSSMDITDVPWQVSLQ-YYGEHFCGGSI 59

  Fly    81 IDERHVLTAAHCVYGYNPTYLRVITGTVEYEKPDAVYFVEEHWIHCNYNSPDYHNDIALIRLNDT 145
            ..:..::|||||:   ......:..|:..::....|..||.:.||..::..:..||:|:::|:..
  Fly    60 YSKTIIITAAHCI---KEGERSIRAGSSLHDSGGVVVGVEAYIIHPQFDKHNMENDVAVLKLSSP 121

  Fly   146 IKFNEYTQPAELPTAPVANGTQLLLTGWGSTELWGDTPDILQKAYLTHVVYSTCQEIMNNDPSNG 210
            :.|::..|...|........:..|.||||....      :::...|..|      ||:..     
  Fly   122 LSFSDSIQTIPLAETDPPTSSSALATGWGRGNF------LIRPRQLQGV------EILIR----- 169

  Fly   211 PCHICTLTTG-------------GQGACHGDSGGPLTHNGVLYGLVN-WGYPCALGVPDSHANVY 261
            |..:|.|..|             |:|.|:|||||||..||.|.|:.: .|....|| ...:|:|.
  Fly   170 PLIVCKLKYGNGVFNEDICAGRMGKGGCYGDSGGPLVFNGQLVGITSRTGNIVCLG-SSLYASVA 233

  Fly   262 YYLEWIRSMI-----SGPCSN 277
            .|..||.|.|     ..|.:|
  Fly   234 RYRNWILSAIDVLHFQAPATN 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 65/231 (28%)
Tryp_SPc 50..269 CDD:238113 66/232 (28%)
Send1NP_608662.1 Tryp_SPc 29..239 CDD:214473 65/231 (28%)
Tryp_SPc 30..239 CDD:238113 64/230 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.