DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17475 and CG11911

DIOPT Version :9

Sequence 1:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_608518.1 Gene:CG11911 / 33206 FlyBaseID:FBgn0031249 Length:277 Species:Drosophila melanogaster


Alignment Length:299 Identity:89/299 - (29%)
Similarity:143/299 - (47%) Gaps:56/299 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 VRLGVVQILVILLACTCYKPISAVRLAQLSEDQLEWISKAEGVNFQNRVINGEDVQLGEAKYQIS 66
            ::|..|.:::.|:|        |.:.|:|| |:|..:..:....|   ||||.:.:...|.|.:|
  Fly     1 MKLITVTLVIALVA--------AAQGAKLS-DKLAKLVPSFATGF---VINGTEAEPHSAPYIVS 53

  Fly    67 LQGMY--GGHICGGCIIDERHVLTAAHCVYGYNPTYLRVITG---TVEYEKPDAVYFVEEHWIHC 126
            |...|  ..|||||.:|::..::|||||:  ..|..:.:|.|   ..|.::......|:...:|.
  Fly    54 LATNYLKHSHICGGTLINKDWIVTAAHCI--SEPVGMSIIAGLHTRAEVDELTQQRQVDFGRVHE 116

  Fly   127 NYNSPDYHNDIALIRLNDTIKFNEYTQPAELPTAPVANGTQLLLTGWGSTELWGDTPDILQKAYL 191
            .|.......||||:.:|::..|||:.|||.||:....:..:..|.|||.           .|:|:
  Fly   117 KYTGGVGPYDIALLHVNESFIFNEWVQPATLPSREQVHEGETHLYGWGQ-----------PKSYI 170

  Fly   192 -----------THVV-YSTCQEIMNNDPSNGP---CHICTLT-TGGQGACHGDSGGPLTHN---- 236
                       |.:: |..|:|.:   |.:.|   .:||:.: ...:.||:|||||||...    
  Fly   171 FSGAKTLQTVTTQILNYEECKEEL---PESAPIAESNICSSSLQQSKSACNGDSGGPLVVEFTNA 232

  Fly   237 -GVLYGLVNWGY-PCAL-GVPDSHANVYYYLEWIRSMIS 272
             ..|.|:|:||| ||.| .:|..:..|..|::||.::.|
  Fly   233 PSELIGIVSWGYIPCGLANMPSIYTKVSAYIDWITNIQS 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 75/245 (31%)
Tryp_SPc 50..269 CDD:238113 77/246 (31%)
CG11911NP_608518.1 Tryp_SPc 37..269 CDD:238113 77/247 (31%)
Tryp_SPc 37..266 CDD:214473 75/244 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6415
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.