DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17475 and CG11912

DIOPT Version :9

Sequence 1:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_608517.1 Gene:CG11912 / 33205 FlyBaseID:FBgn0031248 Length:271 Species:Drosophila melanogaster


Alignment Length:269 Identity:89/269 - (33%)
Similarity:122/269 - (45%) Gaps:34/269 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 ISAVRLAQLSEDQLEWISKAEGVNFQNRVINGEDVQLGEAKYQISLQGMYGGHICGGCIIDERHV 86
            |.|:.||.:|...:......||     |:|||.:...|||.|.:|||.....|.|.|.::||..:
  Fly     7 IFALALASVSAISVPQPGFPEG-----RIINGYEAAKGEAPYIVSLQTTSNSHFCAGSLLDEVTI 66

  Fly    87 LTAAHCVYGYNP------TYLRVITGTVEYEKPDAVYFVEEHWIHCNYNSPDYHNDIALIRL--N 143
            :|||||: .||.      .:.|.....|:..|.....:|    ||.||......|||.||.|  .
  Fly    67 VTAAHCL-TYNQGQAVAGAHSRTDQENVQIRKFTNAQYV----IHENYGGGVGPNDIGLILLKEE 126

  Fly   144 DTIKFNEYTQPAELPTAPVA------NGT-QLLLTGWGSTELWGDTPDILQKAYLTHVVYSTCQE 201
            |....|...:....|.:.|:      .|| ...|.|||.... |..|..|||.....|.|:.|:.
  Fly   127 DAFDLNAVARDGSNPVSAVSLPSKTFQGTSDGYLYGWGRDNS-GLLPLNLQKLDAIIVDYNECKA 190

  Fly   202 IMNNDPSNGPCHICTLTTG-GQGACHGDSGGPL-----THNGVLYGLVNWGY-PC-ALGVPDSHA 258
            .:.::.|....::||.|.| ..|:|:|||||||     :....|.|:|:||| || :...|..:.
  Fly   191 ALPSNNSLAETNVCTHTPGKADGSCNGDSGGPLVSQSSSRGAELIGIVSWGYTPCLSTTYPSVYT 255

  Fly   259 NVYYYLEWI 267
            :|..:|.||
  Fly   256 SVSSFLPWI 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 80/240 (33%)
Tryp_SPc 50..269 CDD:238113 81/241 (34%)
CG11912NP_608517.1 Tryp_SPc 29..264 CDD:214473 80/240 (33%)
Tryp_SPc 30..267 CDD:238113 81/241 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6415
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.