DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17475 and Prss34

DIOPT Version :9

Sequence 1:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_848459.1 Gene:Prss34 / 328780 MGIID:2681414 Length:318 Species:Mus musculus


Alignment Length:269 Identity:75/269 - (27%)
Similarity:117/269 - (43%) Gaps:52/269 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 VINGEDVQLGEAKYQISLQGMYG------GHICGGCIIDERHVLTAAHCV-------YGYNPTYL 101
            ::.|..|......:|:||: :|.      .|.|||.:|..:.||||||||       ||     :
Mouse    35 IVGGCPVSASRFPWQVSLR-LYDMEHSRWEHECGGSLIHPQWVLTAAHCVRPKEVEAYG-----V 93

  Fly   102 RVITGTVEYEKPDAVYFVEEHWIHCNYN---SPDYHNDIALIRLNDTIKFNEYTQPAELPTAP-- 161
            ||..|.:...:.|.:..|.:...|..::   |.....||||::|:..:..:|:..|..||.|.  
Mouse    94 RVQVGQLRLYENDQLMKVVKIIRHPKFSEKLSARGGADIALLKLDTRVVLSEHVYPVSLPAASLR 158

  Fly   162 VANGTQLLLTGWGSTELWGDTPD--ILQKAYLTHVVYSTC-QEIMNNDPSNGPCHIC---TLTTG 220
            :::.....:.|||..|.:...|.  .|::..:..|..:.| |:...|..|:....|.   .|..|
Mouse   159 ISSKKTCWVAGWGVIENYMPLPPPYHLREVAVPIVENNDCEQKYQTNSSSDSTTRIIKDDMLCAG 223

  Fly   221 --GQGACHGDSGGPL----THNGVLYGLVNWGYPCALGVPD---SHANVYYYLEWIRSMISGPCS 276
              |:.:|..||||||    ..:.|..|:|:||..|  |:||   .:..|..|:.||:        
Mouse   224 KEGRDSCKADSGGPLVCRWNCSWVQVGVVSWGIGC--GLPDFPGVYTRVMSYVSWIK-------- 278

  Fly   277 NCHCYASNY 285
               ||...:
Mouse   279 ---CYVPTF 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 71/249 (29%)
Tryp_SPc 50..269 CDD:238113 73/251 (29%)
Prss34NP_848459.1 Tryp_SPc 35..278 CDD:238113 72/250 (29%)
Tryp_SPc 35..277 CDD:214473 71/249 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.