DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17475 and Hayan

DIOPT Version :9

Sequence 1:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_001097020.1 Gene:Hayan / 32831 FlyBaseID:FBgn0030925 Length:637 Species:Drosophila melanogaster


Alignment Length:256 Identity:72/256 - (28%)
Similarity:115/256 - (44%) Gaps:43/256 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 VINGEDVQLGEAKYQISL-QGMYGGHI--CGGCIIDERHVLTAAHCVYG--YNPTYLRVITGTVE 109
            :::||.|..|...:..:: ...:|...  |||.:|..|.||||||||..  ..|:::|:  |.:.
  Fly   385 ILDGERVDRGVYPHMAAIAYNSFGSAAFRCGGSLIASRFVLTAAHCVNSDDSTPSFVRL--GALN 447

  Fly   110 YEKPDAVY---FVEEHWIHCNYNSPDYHNDIALIRLNDTIKFNEYTQPAELPT---APVANGTQL 168
            .|.|:..|   .|.:..||.:|:....:.|||:::|.:..|.::..:||.|.|   .|.|| .:.
  Fly   448 IENPEPGYQDINVIDVQIHPDYSGSSKYYDIAILQLAEDAKESDVIRPACLYTDRSDPPAN-YKY 511

  Fly   169 LLTGWGSTELWG-DTPDILQKAYLTHVVYSTCQEIMNNDPSNGPCHICTLTTG------------ 220
            .:.|||...:.. ....||.:|.|..|....|.......||...    ||..|            
  Fly   512 FVAGWGVMNVTNRAVSKILLRAALDLVPADECNASFAEQPSANR----TLRRGVIASQLCAADKN 572

  Fly   221 -GQGACHGDSGGPL---------THNGVLYGLVNWGYPCALGVPDSHANVYYYLEWIRSMI 271
             .:.||.|||||||         |::  :.|:::.|:.||...|..:..|..:|::|..::
  Fly   573 QRKDACQGDSGGPLILEIDDVDGTYS--IVGVISSGFGCATKTPGLYTRVSSFLDYIEGIV 631

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 71/250 (28%)
Tryp_SPc 50..269 CDD:238113 72/252 (29%)
HayanNP_001097020.1 CLIP 32..80 CDD:197829
Tryp_SPc 384..627 CDD:214473 71/250 (28%)
Tryp_SPc 385..630 CDD:238113 72/253 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437652
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.