DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17475 and CG9676

DIOPT Version :9

Sequence 1:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster


Alignment Length:266 Identity:81/266 - (30%)
Similarity:116/266 - (43%) Gaps:50/266 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 WISK----AEGVNFQN------RVINGEDVQLGEAKYQISLQGMYGGHICGGCIIDERHVLTAAH 91
            |.|.    |.||..||      |::.|...:.|:..:||||: ..|.|.|||.||.:.:|:||||
  Fly     5 WTSLLVLCAAGVLAQNDSVVEPRIVGGTKAREGQFPHQISLR-RRGSHTCGGSIISKDYVVTAAH 68

  Fly    92 CV-YGYN---PTYLRVITGTVEYEKPDAVYFVEEHWIHCNYNSPDYHNDIALIRLNDTIKFNEYT 152
            || .|.|   ...|.:..|::..........|....:|.||||..:  |:|::||.:::.||...
  Fly    69 CVKQGNNVAPANELEIQAGSLLLSSGGVRVPVATVTVHPNYNSNGH--DVAVLRLRNSLTFNSNI 131

  Fly   153 QPAELPTAPVANGTQLLLTGWGSTELWGDTPDIL-------------QKAYLTHVVYSTCQEIMN 204
            ...:|.|....|...:.::|||:....|...:.|             ||.||..:..:|      
  Fly   132 AAIKLATEDPPNDATVDISGWGAISQRGPISNSLLYVQVKALSRESCQKTYLRQLPETT------ 190

  Fly   205 NDPSNGPCHICTLTTGGQGACHGDSGGPLTHNGVLYGLVNW---GYPCALGVPDSHANVYYYLEW 266
                     :|.|....:|||:||||||.|:.|.|.||.::   |  |....||.:..|.....|
  Fly   191 ---------MCLLHPKDKGACYGDSGGPATYQGKLVGLASFVIGG--CGRAAPDGYERVSKLRNW 244

  Fly   267 IRSMIS 272
            |....|
  Fly   245 IAEKAS 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 71/237 (30%)
Tryp_SPc 50..269 CDD:238113 72/238 (30%)
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 71/237 (30%)
Tryp_SPc 28..248 CDD:238113 72/239 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.